CAS 197922-42-2: Teduglutide

Applications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome. References Jeppesen, P., et al.: Gut, 54, 1224 (2005) Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).

Teduglutide is a synthetic peptide that is structurally similar to the human hormone GLP-1. Teduglutide has been shown to be an effective treatment for patients with bowel syndrome, and can be administered by injection or infusion. When injected, teduglutide reaches the intestine in approximately 20 minutes, where it stimulates the release of insulin in response to glucose levels in the blood. Teduglutide has also been shown to stimulate intestinal movement and promote healing of damaged intestinal tissue.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form. One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD