Biochemicals and Reagents

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

TRAP1 antibody was raised in rabbit using the N terminal of TRAP1 as the immunogen

Purified Polyclonal MERTK antibody

Recombinant Human Collagen-VI

Mouse monoclonal CD38 antibody (allophycocyanin)

ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory

Mouse Anti Human CD3-FITC

A synthetic peptide for use as a blocking control in assays to test for specificity of SPRED2 antibody, catalog no. 70R-10053

Recombinant HIV-1 gp120 MN

Mouse monoclonal CCM2 antibody

Rabbit polyclonal TMEM41A antibody

Piperazine-N,N'-bis(2-hydroxypropanesulphonic acid)

Rabbit polyclonal FGR antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PROCA1 antibody, catalog no. 70R-4165

Rabbit polyclonal Ovomucoid antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-1749

Finasteride is an antiandrogenic drug that belongs to the group of 5-alpha reductase inhibitors, which are used for the treatment of benign prostatic hyperplasia and male pattern baldness. The conversion of testosterone to 5α-dihydrotestosterone (DHT) is blocked by type II 5α-reductase inhibition, which then results in significant increase in prostatic testosterone concentrations and minimal to moderate increases in serum and tissue DHT concentrations. A reduction in DHT concentration will cause a reduction in prostatic volume as DHT appears to be the main androgen responsible for stimulating prostatic growth. Finasteride is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf116 antibody, catalog no. 70R-7151

A synthetic peptide for use as a blocking control in assays to test for specificity of ETV1 antibody, catalog no. 70R-7876

Purified Polyclonal ACTN1/2/3/4 antibody

IL12 antibody was raised in goat using highly pure recombinant murine IL-12 as the immunogen.

Peptide H-KMRMATPLLMQALPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KMRMATPLLMQALPM-OH include the following: A Cell-Free Antigen Processing System Reveals Factors Critical for HIV-1 Epitope Dominance and Informs Vaccine Design S Sengupta, MC Reed, J Yu, J Zhang, A Kim - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=3956653 A cell-free antigen processing system informs HIV-1 epitope selection and vaccine design S Sengupta, J Zhang, MC Reed, J Yu, A Kim - Journal of Experimental , 2023 - rupress.orghttps://rupress.org/jem/article/214035/A-cell-free-antigen-processing-system-informs-HIV A pH-sensitive histidine residue as control element for ligand release from HLA-DR molecules O Rötzschke , JM Lau, M Hofstatter - Proceedings of the , 2002 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.212643999 Induction and maintenance of allergen-specific FOXP3+ Treg cells in human tonsils as potential first-line organs of oral tolerance O Palomares, B Ruckert, T Jartti , UC Kucuksezer - Journal of allergy and , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674911015028 Empty and Peptide-Loaded Class II Major Histocompatibility Complex Proteins Produced by Expression inEscherichia coliand Foldingin Vitro M Frayser, AK Sato , L Xu, LJ Stern - Protein expression and purification, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592898909871 Autoantigen Processing. How immunodominant thyroglobulin peptides are generated and presented by HLA-DR molecules D Jaraquemada Perez de Guzman - 2015 - tdx.cathttps://www.tdx.cat/handle/10803/325144 DRB1* 01-DR1, DR103 AANA NA - The HLA FactsBook, 1999 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=ZmZYk2FQiuUC&oi=fnd&pg=PA331&dq=(%22H-KMRMATPLLMQALPM-OH%22+OR+%22KMRMATPLLMQALPM%22)+AND+peptide&ots=aAMyvUQ0qD&sig=PpuL5YAGGnuSToJhU65zXiuzh24

Mouse monoclonal ID3 antibody

DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLR

Rabbit anti-Bovine Whole Serum Antibody

Purified recombinant MCM7 protein (His tag)

Goat anti Human IgM antibody

POGZ antibody was raised in rabbit using the N terminal of POGZ as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM35B antibody, catalog no. 70R-4967

A synthetic peptide for use as a blocking control in assays to test for specificity of CLIon Channel6 antibody, catalog no. 70R-5047

A synthetic peptide for use as a blocking control in assays to test for specificity of ASB6 antibody, catalog no. 70R-5879

PF4V1 antibody was raised using the middle region of PF4V1 corresponding to a region with amino acids RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE

Mouse monoclonal PIM2 antibody

Rabbit polyclonal UQCRFS1 antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of SGCG antibody, catalog no. 70R-1772

A synthetic peptide for use as a blocking control in assays to test for specificity of ASAH1 antibody, catalog no. 70R-5484

BMS 214662 is a farnesyltransferase inhibitor, which is a synthetic compound with specific biochemical properties. It is derived from a series of potent farnesyltransferase inhibitors developed to interfere with prenylation, a post-translational modification critical for the function of several oncogenic proteins. The primary mode of action for BMS 214662 involves the inhibition of farnesyltransferase, an enzyme responsible for the attachment of a farnesyl group to proteins, such as the Ras oncoprotein, thereby impeding their proper localization and function within the cell. BMS 214662 is primarily utilized in the context of cancer research, as the inhibition of Ras farnesylation can disrupt the signaling pathways driving tumor growth and progression. Beyond its role in oncology, this compound is also investigated for its potential effects on other diseases where protein prenylation plays a critical role. Experimental applications typically involve in vitro studies and preclinical trials designed to explore its efficacy, toxicity, and potential therapeutic windows. By understanding its precise mechanisms and effects, scientists endeavor to elucidate its full potential and therapeutic index in complex biological systems.

Mouse monoclonal CK19 antibody

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

Artemisone is a sesquiterpene lactone that has been shown to have significant cytotoxicity against cancer cells, such as K562 cells. It is also an inhibitor of the P-glycoprotein (P-gp) transporter, which may make it useful for treating infectious diseases and drug interactions. Artemisone has also been shown to inhibit the activity of recombinant cytochrome P450 enzymes in vitro. This inhibition could be used to study the biological properties of this enzyme system. Artemisone also inhibits the growth of bacteria, including methicillin-resistant Staphylococcus aureus and Streptococcus pneumoniae. Artemisone has been shown to have anti-inflammatory properties in vitro and has been shown to inhibit prostaglandin synthesis in vivo.

CRIP2 antibody was raised in Rabbit using Human CRIP2 as the immunogen

Rabbit polyclonal PP1 alpha antibody

IL1 alpha antibody was raised in goat using highly pure recombinant rat IL-1a as the immunogen.

ADRBK2 antibody was raised in Rabbit using Human ADRBK2 as the immunogen

Rabbit Polyclonal Gab1 antibody (Tyr627)

Mouse monoclonal PHF21B antibody

Rabbit polyclonal OR4A15 antibody

Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-PHSRN-NH2 include the following: alpha5beta1 integrin ligand PHSRN induces invasion and alpha5 mRNA in endothelial cells to stimulate angiogenesis ZZ Zeng, H Yao, ED Staszewski, KF Rockwood - Translational , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1936523309800028 Use of integrin fibronectin receptor ligands to control endothelial cell invasion and to regulate angiogenesis ZZ Zeng, H Yao, E Staszewski, P Danielsky - Cancer Research, 2007 - AACRhttps://aacrjournals.org/cancerres/article-abstract/67/9_Supplement/3827/535167 Design and Synthesis of the Hydroxamic Acid Variants Antitumorigenic and Antimetastatic Hydroxamate Based Ac-PHSXX'-NH2 Sequences Y Sun, AF Spatola - Peptides: The Wave of the Future: Proceedings of the , 2001 - Springerhttps://link.springer.com/chapter/10.1007/978-94-010-0464-0_374 Collagen-like polypeptide poly (Pro-Hyp-Gly) conjugated with Gly-Arg-Gly-Asp-Ser and Pro-His-Ser-Arg-Asn peptides enhances cell adhesion, migration, and Y Shibasaki, S Hirohara , K Terada, T Ando - Peptide , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.21551 Collagen-Like Polypeptide Poly (Pro-Hyp-Gly) Conjugated with Fibronectin-Derived Peptides Enhances the Cell Adhesion, Migration and Stratification Y Shibasaki, S Hirohara , K Terada, T Ando - European Conference of , 2012 - Springerhttps://link.springer.com/chapter/10.1007/978-3-642-23508-5_282 Recovery of the corneal stroma associated with rapid reepithelialization induced by the fibronectin-derived peptide PHSRN in 2 cases of corneal perforation due to a Y Morita, N Morishige, N Yamada , M Ohta, KH Sonoda - Cornea, 2015 - journals.lww.comhttps://journals.lww.com/corneajrnl/FullText/2015/11000/Recovery_of_the_Corneal_Stroma_Associated_With.30.aspx HUVEC cell affinity evaluation and integrin-mediated mechanism study on PHSRN-modified polymer Y Liu, W Wang , J Wang , Z Yuan, S Tang , M Liu - Colloids and Surfaces B , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0927776510006636 The synergy peptide PHSRN and the adhesion peptide RGD mediate cell adhesion through a common mechanism Y Feng, M Mrksich - Biochemistry, 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi049174+ Design and biological activity of synthetic oligopeptides with Pro-His-Ser-Arg-Asn (PHSRN) and Arg-Gly-Asp (RGD) motifs for human osteoblast-like cell (MG-63) TI Kim, JH Jang, YM Lee, IC Ryu, CP Chung - Biotechnology , 2002 - Springerhttps://link.springer.com/article/10.1023/A:1021368519336 An integrin-activating peptide, PHSRN, ameliorates inhibitory effects of conventional peritoneal dialysis fluids on peritoneal wound healing T Miyamoto, M Tamura, N Kabashima - Nephrology Dialysis , 2010 - academic.oup.comhttps://academic.oup.com/ndt/article-abstract/25/4/1109/1857292 Preparation of PHEMA copolymers containing cell-binding peptides as graft chains and their cell adhesive properties T Koga, Y Teraguchi, N Higashi - of the Materials Research Society of , 2012 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/tmrsj/37/4/37_533/_article/-char/ja/ Effect of RGD secondary structure and the synergy site PHSRN on cell adhesion, spreading and specific integrin engagement SE Ochsenhirt, E Kokkoli , JB McCarthy, M Tirrell - Biomaterials, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961205011749 The short amino acid sequence Pro-His-Ser-Arg-Asn in human fibronectin enhances cell-adhesive function. S Aota, M Nomizu, KM Yamada - Journal of Biological Chemistry, 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925817314564 Up-Regulation of ZO-1 by the Fibronectin-Derived Peptide PHSRN in Cultured Human Corneal Epithelial Cells R Yanai , JA Ko, TI Chikama - Ophthalmology & Visual , 2008 - iovs.arvojournals.orghttps://iovs.arvojournals.org/article.aspx?articleid=2378774 Upregulation of ZO-1 in cultured human corneal epithelial cells by a peptide (PHSRN) corresponding to the second cell-binding site of fibronectin R Yanai , JA Ko, N Nomi, N Morishige - & visual science, 2009 - iovs.arvojournals.orghttps://iovs.arvojournals.org/article.aspx?articleid=2126132 Study on the potential of RGD-and PHSRN-modified alginates as artificial extracellular matrices for engineering bone R Nakaoka, Y Hirano, DJ Mooney , T Tsuchiya - Journal of Artificial , 2013 - Springerhttps://link.springer.com/article/10.1007/s10047-013-0703-7 Open clinical study of eye drops containing the fibronectin-derived peptide PHSRN for treatment of persistent corneal epithelial defects N Yamada , N Morishige, R Yanai , Y Morita, K Kimura - Cornea, 2012 - journals.lww.comhttps://journals.lww.com/corneajrnl/fulltext/2012/12000/open_clinical_study_of_eye_drops_containing_the.9.aspx The Fibronectin-Derived Peptide PHSRN Promotes Corneal Epithelial Wound Healing in Diabetic Rats N Morishige, A Uemura, Y Morita - & Visual Science, 2017 - iovs.arvojournals.orghttps://iovs.arvojournals.org/article.aspx?articleid=2640184 Promotion of corneal epithelial wound healing in diabetic rats by the fibronectin-derived peptide PHSRN N Morishige, A Uemura, Y Morita, T Nishida - Cornea, 2017 - journals.lww.comhttps://journals.lww.com/corneajrnl/FullText/2017/12000/Promotion_of_Corneal_Epithelial_Wound_Healing_in.17.aspx Oxygen ion implantation improving cell adhesion on titanium surfaces through increased attraction of fibronectin PHSRN domain M Shi , W Mo, H Qi, Y Ni, R Wang - Advanced , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adhm.202101983 Stimulation of corneal epithelial migration by a synthetic peptide (PHSRN) corresponding to the second cell-binding site of fibronectin K Kimura, A Hattori, Y Usui, K Kitazawa - & visual science, 2007 - iovs.arvojournals.orghttps://iovs.arvojournals.org/article.aspx?articleid=2125363 Amino acids and peptides. Part 39: A bivalent poly (ethylene glycol) hybrid containing an active site (RGD) and its synergistic site (PHSRN) of fibronectin K Hojo, Y Susuki, M Maeda, I Okazaki - Bioorganic & medicinal , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0960894X01002256 Using self-assembled monolayers to model cell adhesion to the 9th and 10th type III domains of fibronectin JL Eisenberg, JL Piper, M Mrksich - Langmuir, 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/la901528c Up-regulation of HSP70 by the fibronectin-derived peptide PHSRN in human corneal epithelial cells JA Ko, R Yanai , WY Quan, N Morishige - and biophysical research , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X08005743 Synergistic Adhesiveness of Fibronectin with PHSRN Peptide in Gelatin Mixture Promotes the Therapeutic Potential of Human ES-Derived MSCs HS Kim , SH Choi, ML Kang, KW Lee, KN Kim - Cellular and Molecular , 2020 - Springerhttps://link.springer.com/article/10.1007/s12195-019-00604-0 The effect on osteoblast function of colocalized RGD and PHSRN epitopes on PEG surfaces DSW Benoit , KS Anseth - Biomaterials, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961205000815 Ac-PHSCN-NH2 DM Veine, H Yao, DR Stafford, KS Fay, DL Livant - smad - smadinhibitors.comhttps://smadinhibitors.com/nmur2/ac-phscn-nh2/ Anti-invasive, antitumorigenic, and antimetastatic activities of the PHSCN sequence in prostate carcinoma DL Livant, RK Brabec, KJ Pienta , DL Allen, K Kurachi - Cancer research, 2000 - AACRhttps://aacrjournals.org/cancerres/article-abstract/60/2/309/506740 The PHSRN sequence induces extracellular matrix invasion and accelerates wound healing in obese diabetic mice DL Livant, RK Brabec, K Kurachi - The Journal of , 2000 - Am Soc Clin Investighttps://www.jci.org/articles/view/8527 The PhScN peptide as a highly potent inhibitor of basement membrane invasion in vitro and lung colonization in nude mice by metastatic human prostate cancer cells DL Livant, H Yao, DM Veine, KS Fay - Cancer Research, 2012 - AACRhttps://aacrjournals.org/cancerres/article/72/8_Supplement/3890/580745 Role of Focal Adhesion Kinase and Phosphatidylinositol 3 DI by Metastatic - Cancer Res, 2006 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=826c35a512fbc740fef3b066154c535483df8af5 Synthetic alpha5beta1 integrin ligand PHSRN is proangiogenic and neuroprotective in cerebral ischemic stroke CC Wu , LC Wang , YT Su, WY Wei, KJ Tsai - Biomaterials, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961218306458 Surface adsorption of fibronectin-derived peptide fragments: the influence of electrostatics and hydrophobicity for endothelial cells adhesion C Satriano , ME Fragalaca , G Forte, AM Santoro - Soft Matter, 2012 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2012/sm/c1sm06655b Surface immobilization of fibronectin-derived PHSRN peptide on functionalized polymer films-Effects on fibroblast spreading C Satriano , GML Messina, C Marino, I Aiello - Journal of colloid and , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021979709012594 Biomimetic peptide-amphiphiles for functional biomaterials: the role of GRGDSP and PHSRN A Mardilovich, E Kokkoli - Biomacromolecules, 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bm0344351 Copper (II) coordination properties of the integrin ligand sequence PHSRN and its new beta-cyclodextrin conjugates A Magraca¬ , F D'Alessandro, DA Distefano - Journal Of Inorganic , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0162013412001055 Stimulation of corneal epithelial migration by a peptide corresponding to the PHSRN sequence of fibronectin A Hattori, Y Usui, K Kitazawa - & Visual Science, 2005 - iovs.arvojournals.orghttps://iovs.arvojournals.org/article.aspx?articleid=2401583 Sequence specificity of the PHSRN peptide from fibronectin on corneal epithelial migration A Hattori, K Hozumi, JA Ko, T Chikama - Biochemical and , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X08024595

Recombinant human MAF1 protein

C13orf18 antibody was raised in Rabbit using Human C13orf18 as the immunogen

Purified Polyclonal TCEAL6 antibody

KIAA1754L antibody was raised using the C terminal of KIAA1754L corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT

The TDG antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is an activated antibody that specifically targets and binds to TDG (Thymine-DNA glycosylase), an enzyme involved in DNA repair and growth factor regulation. This antibody has been extensively used in research and diagnostic applications to study the mechanisms of DNA repair, as well as to investigate the role of TDG in various biological processes. One of the key applications of the TDG antibody is its use in studying insulin signaling pathways. Insulin is a vital hormone that regulates glucose metabolism and plays a crucial role in diabetes. By targeting insulin and its associated proteins, this antibody enables researchers to gain insights into the intricate molecular interactions involved in insulin signaling. Moreover, the TDG antibody has been employed in studies related to glycosylation, phosphatase activity, alkaline phosphatases, tyrosinase, and other important cellular processes. Its high specificity and sensitivity make it an invaluable

Troponin I antibody (cardiac) was raised in mouse using amino acid residues 25-40 of cTnI as the immunogen.

1-((S)-2-Amino-propyl)-1H-indazol-6-ol is a potent, selective 5HT receptor agonist. It is used in scientific research for the study of serotonergic neurotransmission and has been shown to have antihypertensive effects on the trabecular meshwork. 1-(2-Aminoethyl)indazole has affinity for 5HT receptors, and has been shown to be a potent serotonin antagonist at 5HT2C receptors. This drug also potently inhibits muscle contraction.

Goat anti-bovine IgG (biotin) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.

Mouse monoclonal DYNC1LI1 antibody

NoxA1ds is a reactive drug molecule that inhibits the enzyme nitric oxide synthase. This class of drugs has been shown to inhibit endothelial cell proliferation, but its clinical relevance is not yet clear. It has been shown to be active in the treatment of inflammatory bowel disease, as well as cancer and chronic kidney disease. NoxA1ds binds to the enzyme nitric oxide synthase and prevents it from synthesizing nitric oxide, thereby inhibiting angiogenesis. The mechanism of action for this drug is similar to that of antiangiogenic therapy.

Mouse monoclonal FMR1 antibody

H-NTRPPHGNWF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NTRPPHGNWF-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NTRPPHGNWF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NTRPPHGNWF-OH at the technical inquiry form on this page

ITFG1 antibody was raised in Rabbit using Human ITFG1 as the immunogen

Please enquire for more information about Benzomalvin C including the price, delivery time and more detailed product information at the technical inquiry form on this page

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified Polyclonal Cyclin A1/2 antibody

RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA

Yersinia enterocolitica O:9 antibody was raised in mouse using Yersinia enterocolitica serogroup O:9 strain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF5A2 antibody, catalog no. 70R-3877

Peptide H-SLAFLPESFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLAFLPESFD-OH include the following: Enzymatic discovery of a HER-2/neu epitope that generates cross-reactive T cells AM Henle , CL Erskine, LM Benson - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/190/1/479/86534

The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (466-480) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

Mouse monoclonal FAM40A antibody

Please enquire for more information about Sermorelin acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ligand binding to type I receptors with a common subunit gamma result in local cytoplasmic Jak3 being recruited to the cytoplasmic tails of the receptor. The tail becomes phosphorylated creating STAT protein binding sites. The STAT complex then also becomes phosphorylated to form a homo/heterodimer and translocate to the nucleus to bind to DNA to activate transcription. For example, interleukin IL2 binds type I receptor ILR2 resulting in Jak1 with Jak3 recruitment to the cytoplasmic gamma subunit. This interaction leads to tyrosine phosphorylation of the receptor for Stat5A with Stat5B docking. These STATs are then phosphorylated and activated by Jak1 and Jak3 leading to their dimerization and translocation for activation of specific gene transcription.Jak3 also has vital roles in immune cell signalling pathways; IL2 binds IL2R on T cells and natural killer cells. It has been found that in these immune cells Jak3 is critical to facilitate tyrosine phosphorylation of the cytoplasmic IL2R subunit. Throughout T cell differentiation Jak3 is required for IL7 induced activation of IL7R to activate PI3k and STATs. Ablation of Jak3 completely halted T cell proliferation.  JAK3-deficient models have phenotypes like human severe combined immunodeficiency (SCID), due to the lack of developed lymphocytes. This was linked to the interaction found between Jak3 and the T cell protein tyrosine phosphatases (TCPTP) key to cytokine signalling in haematopoietic cells.

Rabbit polyclonal WEE1 antibody

Rabbit polyclonal Estrogen Receptor alpha antibody

TRIM72 antibody was raised using the N terminal of TRIM72 corresponding to a region with amino acids CASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQ

hepatitis B antibody was raised in mouse using hepatitis B surface antigen as the immunogen.

Please enquire for more information about 3-Bromo-2-(1-methoxybutyl)benzofuran including the price, delivery time and more detailed product information at the technical inquiry form on this page

Ac-GSEPGASMPPPFSVEC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-GSEPGASMPPPFSVEC-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-GSEPGASMPPPFSVEC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-GSEPGASMPPPFSVEC-NH2 at the technical inquiry form on this page

Rabbit polyclonal PTDSS1 antibody (biotin)

Mouse monoclonal MAPRE2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ARL8B antibody, catalog no. 70R-3486

A synthetic peptide for use as a blocking control in assays to test for specificity of MTO1 antibody, catalog no. 70R-2514

Rabbit polyclonal alpha Synuclein antibody

Peptide H-LFEELVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LFEELVR^-OH include the following: Mass spectrometric analysis reveals O-methylation of pyruvate kinase from pancreatic cancer cells W Zhou, M Capello , C Fredolini , L Racanicchi - Analytical and , 2013 - Springerhttps://link.springer.com/article/10.1007/s00216-013-6880-7 Defining the proteome of human iris, ciliary body, retinal pigment epithelium, and choroid P Zhang , D Kirby, C Dufresne , Y Chen , R Turner - , 2016 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201500188 No evidence for a shift in pyruvate kinase PKM1 to PKM2 expression during tumorigenesis K Bluemlein, NM Gruning, RG Feichtinger, H Lehrach - Oncotarget, 2011 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3248187/

EIF3M antibody was raised in Rabbit using Human EIF3M as the immunogen