Biochemicals and Reagents

Purified recombinant PAFAH1B3 protein (His tag)

Mirodenafil dihydrochloride is a potent phosphodiesterase-5 (PDE5) inhibitor, which is a synthetic compound with a primarily chemical origin. Its mode of action involves the inhibition of the enzyme PDE5, which predominantly resides in the smooth muscle cells lining blood vessels. By inhibiting PDE5, Mirodenafil dihydrochloride effectively increases the levels of cyclic guanosine monophosphate (cGMP), leading to the relaxation of smooth muscle tissues and vasodilation. This mechanism of action makes Mirodenafil dihydrochloride particularly effective in the treatment of erectile dysfunction (ED). By enhancing blood flow to specific areas of the body, primarily the corpus cavernosum of the penis, it facilitates the achievement and maintenance of an erection in response to sexual stimulation. The compound’s selectivity for PDE5 over other phosphodiesterases minimizes potential side effects and enhances its therapeutic efficacy. As such, Mirodenafil dihydrochloride serves as a valuable tool in clinical settings for managing erectile dysfunction, providing an alternative for patients who may not respond to or tolerate other PDE5 inhibitors.

Applications Lincomycin N-Oxide is an analog of Lincomycin (L466230). Lincomycin is a lincosamide antibiotic that forms cross-links within the peptidyl transferase loop region of the 23S rRNA. Inhibits bacterial protein synthesis. Antibacterial. This compound is a contaminant of emerging concern (CECs). References Mason, D.J., et al.: Antimicrob. Agents Chemother., 555 (1962);Gray, et al.: Toxicol. Appl. Pharmacol., 6, 476 (1964);Muti, H.Y., et al.: Anal. Profiles Drug Subs. Excip., 23, 269 (1994)

Biotin-SARS-CoV-2 Spike RBD 371-394 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 371-394 peptide. SARS-CoV-2 Spike RBD 371-394 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 371-394 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.

DDOST antibody was raised in Rabbit using Human DDOST as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SR140 antibody, catalog no. 70R-4843

Purified recombinant Human PTGR1 protein (His tag)

N-Acetylglucosamine endo-β-galactosidase 16C from Clostridium perfringens

Rabbit polyclonal MNK1 antibody (Thr255)

ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

3-(Boc-amino)piperidine is used as an organic chemical synthesis intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Mouse monoclonal Cytokeratin 10 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ARGFX antibody, catalog no. 20R-1259

Selective blocker of muscular nACh receptors

Rabbit polyclonal OR10G4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RFP2 antibody, catalog no. 70R-8017

A synthetic peptide for use as a blocking control in assays to test for specificity of GNL3 antibody, catalog no. 70R-3045

Recombinant Human UBE2E3 protein with His tag

A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM19 antibody, catalog no. 70R-7210

Fmoc-Lys(Me)3-OH chloride

Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH include the following: Characterizations of a neutralizing antibody broadly reactive to multiple gluten peptide: HLA-DQ2. 5 complexes in the context of celiac disease Y Okura, Y Ikawa-Teranishi, A Mizoroki - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41467-023-44083-4 Tetramer visualization of gut-homing gluten-specific T cells in the peripheral blood of celiac disease patients M Raki, LE Fallang, M Brottveit - Proceedings of the , 2007 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0608610104 The effects of ALV003 pre-digestion of gluten on immune response and symptoms in celiac disease in vivo JA Tye-Din, RP Anderson , RA Ffrench , GJ Brown - Clinical , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1521661609008651 Inhibition of HLA-DQ2-mediated antigen presentation by analogues of a high affinity 33-residue peptide from alpha2-gliadin J Xia , M Siegel , E Bergseng, LM Sollid - Journal of the American , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja056423o Equilibrium and kinetic analysis of the unusual binding behavior of a highly immunogenic gluten peptide to HLA-DQ2 J Xia , LM Sollid , C Khosla - Biochemistry, 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi047747c On the IgA antibody response to gluten in celiac disease aca˜ Steinsbo - 2015 - duo.uio.nohttps://www.duo.uio.no/handle/10852/48199

A synthetic peptide for use as a blocking control in assays to test for specificity of CLIon Channel5 antibody, catalog no. 70R-1515

Rabbit polyclonal ORC1L antibody

4-Methylumbelliferyl-α-D-galactopyranoside

WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPV5 antibody, catalog no. 70R-5176

ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Amino-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

1-133 amino acids: MRAPIPEPKP GDLIEIFRPF YRHWAIYVGD GYVVHLAPPS EVAGAGAASV MSALTDKAIV KKELLYDVAG SDKYQVNNKH DDKYSPLPCS KIIQRAEELV GQEVLYKLTS ENCEHFVNEL RYGVARSDQV RDV

Purified native Human Human Growth Hormone (> 60% pure)

Allergic Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Allergic Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Canine monoclonal antibody targeting Nerve Growth Factor (NGF); pain control for osteoarthritis in dogs

Upf1/Rent1 (pThr28) Antibody

Rabbit polyclonal PRKRA antibody

Bromothymol Blue is a pH indicator used for measuring pH around 7 in pools and fish tanks. It operates in the pH range 6.0 to 7.6 due to the presence of an electron withdrawing and donating groups like bromine atoms and alkyl substitutents respectively. In the laboratory, it is used as a biological slide stain as well as used in obstetrics for detecting premature rupture of membranes. Further, it is used for the observation of photosynthetic activities and a respiratory indicator. In addition to this, it is used to define cell walls or nuclei under the microscope. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Mouse monoclonal NOP1 antibody

H-RYVPRSCGSNSYVLVPV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RYVPRSCGSNSYVLVPV-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RYVPRSCGSNSYVLVPV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RYVPRSCGSNSYVLVPV-OH at the technical inquiry form on this page

CCT4 antibody was raised in Rabbit using Human CCT4 as the immunogen

POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen

Clickable Arg9 peptide.

Peptide H-DAVQATKPDMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DAVQATKPDMR^-OH include the following: Rapid detection of colistin resistance protein MCR-1 by LC-MS/MS H Wang, Y Chen, JR Strich , SK Drake, JH Youn - Clinical proteomics, 2019 - Springerhttps://link.springer.com/article/10.1186/s12014-019-9228-2

N6AMT2 antibody was raised in Rabbit using Human N6AMT2 as the immunogen

Doxorubicin hydrochloride

Rat anti-mouse IgG2a (biotin) was raised in rat using murine IgG as the immunogen.

Tos-PEG5-CH2CO2t-butyl ester

Rabbit polyclonal ALK antibody

The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (551-565) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

Rat monoclonal CD45R antibody

Peptide H-RGLYFPAGGSSSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RGLYFPAGGSSSG-OH include the following: Interferon-γ facilitates hepatic antiviral T cell retention for the maintenance of liver-induced systemic tolerance Z Zeng, L Li, Y Chen, H Wei, R Sun - Journal of Experimental , 2016 - rupress.orghttps://rupress.org/jem/article-abstract/213/6/1079/42080 Th1-LIKE HBV-SPECIFIC CD4+ T CELLS ARE ABLE TO REVERT THE CD8+ T CELL DYSFUNCTION INDUCED BY HEPATOCELLULAR PRIMING V Venzin - 2023 - iris.unisr.ithttps://iris.unisr.it/handle/20.500.11768/137016 Plasmid vector-linked maturation of natural killer (NK) cells is coupled to antigen-dependent NK cell activation during DNA-based immunization in mice R Zhu, M Mancini-Bourgine, XM Zhang - Journal of , 2011 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.00062-11 Synthetic innate defense regulator peptide combination using CpG ODN as a novel adjuvant induces long"‘lasting and balanced immune responses CH Yu, ZC Luo , M Li, L Lu, Z Li - Molecular , 2016 - spandidos-publications.comhttps://www.spandidos-publications.com/10.3892/mmr.2015.4581?text=abstract Interleukin-22 as a molecular adjuvant facilitates IL-17-producing CD8+ T cell responses against a HBV DNA vaccine in mice B Wu , Q Zou , Y Hu, B Wang - Human Vaccines & , 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/hv.26047 Identification of novel HLA-DR1-restricted epitopes from the hepatitis B virus envelope protein in mice expressing HLA-DR1 and vaccinated human subjects A Pajot, ML Michel, M Mancini-Bourgine - Microbes and , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1286457906003042

Rat sequence expressed in E. coli Cells; purity >98% by SDS-PAGE and HPLC.

Rabbit polyclonal ZAP70 antibody (Tyr493)

The ANT2 antibody is a highly activated nuclear antibody that has been developed as an inhibitor for various immunoassays. It specifically targets neurotrophic factors and can be used as a monoclonal antibody in research and diagnostic applications. Additionally, the ANT2 antibody has shown inhibitory properties against TGF-β1, chemokines, and TNF-α. Its neutralizing capabilities make it a valuable tool for studying the effects of these factors on cellular processes. With its immobilization potential and anti-CD33 antibody properties, the ANT2 antibody offers researchers a versatile option for their experiments.

H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of AURKA antibody, catalog no. 70R-7853

α-Gliadin (58-73) is derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th1-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.

Inhibitor of BACE1 protease

Region of GM-CSF protein corresponding to amino acids MAPTRSPITV TRPWKHVEAI KEALNLLDDM PVTLNEEVEV VSNEFSFKKL TCVQTRLKIF EQGLRGNFTK LKGALNMTAS YYQTYCPPTP ETDCETQVTT YADFIDSLKT FLTDIPFECK KPVQK.

BRF1 antibody was raised in mouse using recombinant Brf1 Homolog, Subunit Of Rna Polymerase Iii Transcription Initiation Factor Iiib (S. Cerevisiae) (Brf1)

Rabbit polyclonal CTDNEP1 antibody (FITC)

Affinity purified Rabbit polyclonal NOSIP antibody

Rabbit polyclonal GluR1 antibody

Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLLKLTPLL-OH include the following: Allo-HLA-reactive T cells inducing graft-versus-host disease are single peptide specific AL Amir, DM van der Steen- Blood, The Journal ..., 2011 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/118/26/6733/29417

Purified Rabbit polyclonal VAV3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A7 antibody, catalog no. 70R-7502