Biochemicals and Reagents

CC-92480 is an immunomodulatory drug that has been shown to inhibit T-cell proliferation and induce apoptosis in some cases. It has been shown to activate markers of autologous stem cells, potent inhibition of t-cell proliferation, and clinical studies have shown it to be safe in humans. CC-92480 increases the production of anti-inflammatory cytokines and inhibits lipid peroxidation. CC-92480 also binds to the surface of cancer cells, which may trigger an immune response against cancer cells. The safety profile is similar to pomalidomide, a related compound that is used for the treatment of multiple myeloma.

FABP antibody was raised in goat using purifed FABP from human heart tissue as the immunogen.

Human sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSGSSLIR^-OH include the following: Distinct roles of ezrin, radixin and moesin in maintaining the plasma membrane localizations and functions of human blood-brain barrier transporters Y Hoshi, Y Uchida, T Kuroda - Journal of Cerebral , 2020 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/0271678X19868880

Purified recombinant UBE2C protein (His tag)

Cobimetinib R-enantiomer

Purified recombinant GDI1 protein (His tag)

Goat anti-Bovine IgG (H + L) (HRP) was raised in goat using purified Bovine IgG (H&L) as the immunogen.

Mouse monoclonal Ghrelin antibody (Biotin)

H-CGGKKLNVAH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGKKLNVAH-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGKKLNVAH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGKKLNVAH-OH at the technical inquiry form on this page

Mouse monoclonal MRRF antibody

Pf-06700841 is a peptide that can be used as a research tool for the study of ion channels and protein interactions. It is an inhibitor of the potassium channel, which is involved in the regulation of neuronal excitability. Pf-06700841 also blocks L-type calcium channels, which are important in cell proliferation and differentiation. Pf-06700841 has been shown to inhibit receptor binding at low concentrations, with increased potency at higher concentrations. At high concentrations, it acts as a ligand to activate G protein coupled receptors. Pf-06700841 has been shown to reduce pain in animal models by blocking pain receptors as well as inhibiting the release of inflammatory cytokines from immune cells.

Dengue Virus Subtype 4 Envelope 45kDa (recombinant) is a recombinant protein that binds to the receptor with high affinity. This protein can be used as an inhibitor in research and has been shown to inhibit ion channels. It is a high-purity, research tool that can be used in life sciences and to study protein interactions.

SD 2590 is a research tool used in Cell Biology, Pharmacology, and Ion channels. SD 2590 is an inhibitor that reacts with peptides, receptors, and ion channels. It also has the ability to activate ligand-gated ion channels. SD 2590 is a high-purity product that is available in quantities of 100mg or 1g.

ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA

Donkey anti-mouse IgG (H + L) (Fab'2) (HRP) was raised in donkey using murine IgG (H&L) as the immunogen.

Purified recombinant Human ARF1 protein

Sphingosine is a sphingolipid that can be found in human cells and plays an important role in signal transduction. Sphingosine is synthesized by the enzyme sphingosine kinase from sphinganine, which is a product of the breakdown of phospholipids. It also has a basic structure that can be used to inhibit the activity of protein kinases, such as PKC and Src, and tumor necrosis factor alpha. Sphingosine is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

HCV Core/NS3/NS4/NS5 Antigen, Recombinant is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about HCV Core/NS3/NS4/NS5 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

MRPL45 antibody was raised in Rabbit using Human MRPL45 as the immunogen

Peptide H-VVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VVIA-OH include the following: Peptidotriazolamers Inhibit Aβ (1-42) Oligomerization and Cross a Blood-Brain-Barrier Model N Tonali, L Hericks, DC Schröder, O Kracker- ..., 2021 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cplu.202000814 Partitioning of Aβ Peptide Fragments into Blood-Brain Barrier Mimetic Bilayer CM Siwy, BM Delfing , C Lockhart - The Journal of ..., 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jpcb.0c11253 Breaker peptides against amyloid-β aggregation: a potential therapeutic strategy for Alzheimer's disease N Ghosh, LM Kundu - Future Medicinal Chemistry, 2021 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4155/fmc-2021-0184 Successive cleavage of β-amyloid precursor protein by gamma-secretase S Funamoto, S Tagami, M Okochi- Seminars in cell & ..., 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1084952119302794 Improving the Sustainability of Peptide and Polymer Chemistry S Lawrenson - 2018 - etheses.whiterose.ac.ukhttps://etheses.whiterose.ac.uk/21397/ Identification of small peptides in human cerebrospinal fluid upon amyloid-β degradation N Mizuta, K Yanagida, T Kodama - Neurodegenerative ..., 2017 - karger.comhttps://karger.com/ndd/article/17/2-3/103/207526 Design of a molecular hybrid of dual peptide inhibitors coupled on AuNPs for enhanced inhibition of amyloid β-protein aggregation and cytotoxicity N Xiong, Y Zhao, X Dong, J Zheng , Y Sun - Small, 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/smll.201601666 Peptide synthesis: ball-milling, in solution, or on solid support, what is the best strategy? O Maurin, P Verdié , G Subra , F Lamaty- Beilstein Journal of ..., 2017 - beilstein-journals.orghttps://www.beilstein-journals.org/bjoc/articles/13/206 Atomistic characterization of binding modes and affinity of peptide inhibitors to amyloid-β protein F Liu , W Du, Y Sun, J Zheng , X Dong - Frontiers of Chemical Science and ..., 2014 - Springerhttps://link.springer.com/article/10.1007/s11705-014-1454-6 gamma-Secretase associated with lipid rafts: multiple interactive pathways in the stepwise processing of β-carboxyl-terminal fragment N Matsumura, M Takami, M Okochi- Journal of Biological ..., 2014 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)44149-3/pdf Molecular dynamics simulation and binding free energy calculation of the conformational transition of amyloid peptide 42 inhibited by peptide inhibitors X DONG, W DU, F LIU - Acta Physico-Chimica Sinica, 2012 - ingentaconnect.comhttps://www.ingentaconnect.com/content/apcs/apcs/2012/00000028/00000011/art00030 C-terminal tetrapeptides inhibit Aβ42-induced neurotoxicity primarily through specific interaction at the N-terminus of Aβ42 H Li, Z Du, DHJ Lopes , EA Fradinger- Journal of medicinal ..., 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm200982p Multifunctional Oligopeptides as an Artificial Toolkit for Molecular Recognition Events PR Wich - 2009 - opus.bibliothek.uni-wuerzburg.dehttps://opus.bibliothek.uni-wuerzburg.de/frontdoor/index/index/docId/3159 gamma-Secretase: successive tripeptide and tetrapeptide release from the transmembrane domain of β-carboxyl terminal fragment M Takami, Y Nagashima, Y Sano- Journal of ..., 2009 - Soc Neurosciencehttps://www.jneurosci.org/content/29/41/13042.short Rapid Sequencing of Split-and-Mix Peptide Receptor Libraries-Identification of Binding Partners for Val-Val-Ile-Ala in Aqueous Solution J Shepherd, GJ Langley , JM Herniman, JD Kilburn - 2007 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/ejoc.200601004 Combinatorial approaches to peptide receptors J Shepherd - 2005 - eprints.soton.ac.ukhttps://eprints.soton.ac.uk/466566/

Rabbit polyclonal IR antibody

Purified recombinant CARD17 protein (His tag)

Catalogue peptide; min. 95% purity

Murashige Fern multiplication medium

Rabbit polyclonal HDAC1 antibody

Binds to collapsing response mediator protein 2 (CRMP2); neurotrophic agent

Region of APRIL protein corresponding to amino acids MRREVSRLQR SGGPSQKQGE RPWQSLWEQS PDVLEAWKDG AKSRRRRAVL TQKHKKKHSV LHLVPVNITS KDSDVTEVMW QPVLRRGRGL EAQGDIVRVW DTGIYLLYSQ VLFHDVTFTM GQVVSREGQG RRETLFRCIR SMPSDPDRAY NSCYSAGVFH LHQGDIITVK IPRANAKLSL SPHGTFLGFV KL.

H-GLFTA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLFTA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLFTA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLFTA-OH at the technical inquiry form on this page

Mouse monoclonal GCG antibody

Prim1 antibody was raised in rabbit using the C terminal of Prim1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PCBP2 antibody, catalog no. 70R-1465

RELB antibody was raised in rabbit using the N terminal of RELB as the immunogen

1,2-Di-O-lauryl-rac-glycero-3-(glutaric acid 6-methylresorufin ester)

Please enquire for more information about Candida Albicans Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal SIV mac251 gp120 antibody (FITC)

Purified Polyclonal CLIP2 antibody

Rabbit polyclonal TESC antibody

Recombinant Human RPL35 protein

Peptide H-ALHFAISEYNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALHFAISEYNK-OH include the following: Comparative proteomic analysis of human whole saliva CM Huang - Archives of Oral Biology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003996904001293

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf103 antibody, catalog no. 70R-4298

Affinity purified Rabbit polyclonal ACAD8 antibody

This sequence corresponds to the peptide bond between mammalian Lys27- (K27) linked Ub proteins- where (GG) corresponds to the C-terminus of the side chain appended Ub.K27-linked chains are less well characterised than other Ub chains, however they have been suggested as a marker of mitochondrial damage and have also been implicated in regulation of innate immunity and DNA repair.The C-terminal lysine residue of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (2), giving this peptide a mass increase of 8 compared to the unlabelled peptide.

WAY 316606 is a potent, orally administered small molecule that inhibits the Wnt signaling pathway by blocking the action of β-catenin. It has been shown to have potential for treating eye disorders, including age-related macular degeneration. This drug also has potential for treatment of cell and nervous system diseases such as Alzheimer's disease and Huntington's disease. WAY 316606 inhibits the transcriptional activity of the β-catenin/Tcf4 complex by binding to it and preventing its translocation into the nucleus. In addition, WAY 316606 prevents downstream activation of genes regulated by β-catenin signaling, including c-myc and cyclin D1. This drug also blocks growth factor receptor tyrosine kinases and monoclonal antibodies that activate these receptors.

Purified Polyclonal Kallikrein 8 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DAZAP1 antibody, catalog no. 70R-4717

A synthetic peptide for use as a blocking control in assays to test for specificity of NCKAP1L antibody, catalog no. 70R-8714

Peptide H-QSSFYSDWY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QSSFYSDWY-OH include the following: Impact of MHC class I alleles on the M. tuberculosis antigen-specific CD8+ T-cell response in patients with pulmonary tuberculosis FF Weichold, S Mueller , C Kortsik, WE Hitzler - Genes & , 2007 - nature.comhttps://www.nature.com/articles/6364392

Affinity purified Rabbit polyclonal PRPSAP2 antibody

14:0-d27 Lyso pc is a peptide fragment derived from the N-terminal region of the rat brain protein, phospholipase A2, which has been identified as an inhibitor of phospholipase A2. It has been used as a research tool in cell biology and pharmacology to study protein-protein interactions, receptor activation, and ion channels. 14:0-d27 Lyso pc is also used as a ligand for radioactive isotopes to study protein localization. 14:0-d27 Lyso pc binds to the phospholipid membrane and blocks the binding of calcium ions to phospholipids, thereby inhibiting enzymatic activity. The inhibition of enzymatic activity leads to reduced production of arachidonic acid, which is an inflammatory mediator. This peptide fragment has also been shown to bind with high affinity to erythrocytes and inhibits platelet aggregation.

Musk active human is a natural substance that belongs to the group of fatty acids. It is found in the musk gland of various animals, including deer, beaver, and otter. Musk active human has been shown to regulate protein glycosylation, which is important for biological function. Musk active human's function in the endoplasmic reticulum is to stabilize proteins and control the process of protein synthesis. A study on an acetylcholine receptor found that it can activate tyrosine kinase, which leads to pathogenic mechanisms. This compound has been expressed in a variety of tissues and seems to play a role in muscle activity. A silico analysis has also shown that this chemical may inhibit the production of sulfoxide through its interaction with enzymes such as cyclooxygenase-2.

Rabbit polyclonal CTRO antibody

The GILZ antibody is a growth factor that has been widely used as a diagnostic agent in various fields of research, including Life Sciences. It is a cationic antibody that exhibits strong biological effects and can be used as a fluorescent probe or photocatalytic agent. The GILZ antibody is typically conjugated with pluronic p123 to enhance its particle chemiluminescence properties. This monoclonal antibody specifically targets and binds to the antigen binding domain, allowing for accurate detection and analysis of specific molecules or proteins. With its activated state and high affinity for target antigens, the GILZ antibody provides researchers with a powerful tool for studying cellular processes and identifying potential therapeutic targets.

FAM78B antibody was raised using the middle region of FAM78B corresponding to a region with amino acids PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRM

PTPMT1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

H-CIQARWKYDGDDDCLDGSD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CIQARWKYDGDDDCLDGSD-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CIQARWKYDGDDDCLDGSD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CIQARWKYDGDDDCLDGSD-OH at the technical inquiry form on this page

ZNF280A antibody was raised in rabbit using the C terminal of ZNF280A as the immunogen

FLJ13798 antibody was raised in rabbit using the C terminal of FLJ13798 as the immunogen

Affinity purified Rabbit polyclonal NIR1 antibody

Neuropeptide W-30 (Rat) is a peptide that belongs to the family of neuropeptides. It has been identified as an inhibitor of the ion channel TRPV1 and TRPA1, which are involved in pain perception. Neuropeptide W-30 (Rat) also inhibits the activation of phospholipase C, protein kinase C, and cAMP response element binding protein. Neuropeptide W-30 (Rat) is used as a research tool for studying protein interactions and for pharmacological studies.

A synthetic peptide for use as a blocking control in assays to test for specificity of KLRF1 antibody, catalog no. 70R-5966

Peptide H-YGFIEGHVVIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YGFIEGHVVIPR^-OH include the following: The DC-SIGN family member LSECtin is a novel ligand of CD44 on activated T cells L Tang, J Yang, X Tang, W Ying - European journal of , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200939936 Algorithms for characterizing peptides and glycopeptides with mass spectrometry L He - 2013 - uwspace.uwaterloo.cahttps://uwspace.uwaterloo.ca/handle/10012/7920 The monoclonal antibody 6B9 recognizes CD44 and not cell surface transglutaminase 2 J Stamnaes , B Fleckenstein - Scandinavian , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-3083.2008.02173.x Cell surface Thomsen-Friedenreich proteome profiling of metastatic prostate cancer cells reveals potential link with cancer stem cell-like phenotype F Li , OV Glinskii , BP Mooney , K Rittenhouse-Olson - Oncotarget, 2017 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5716753/

36-192 amino acids: MGSSHHHHHH SSGLVPRGSH MNFGRLHCTT AVIRNINDQV LFVDKRQPVF EDMTDIDQSA SEPQTRLIIY MYKDSEVRGL AVTLSVKDSK MSTLSCKNKI ISFEEMDPPE NIDDIQSDLI FFQKRVPGHN KMEFESSLYE GHFLACQKED DAFKLILKKK DENGDKSVMF TLTNLHQS

Please enquire for more information about ARRY-382 including the price, delivery time and more detailed product information at the technical inquiry form on this page

FOXP2 antibody was raised in Rabbit using Human FOXP2 as the immunogen

CEA protein is a native protein and antigen that plays a crucial role in various biological processes. It is involved in hepatocyte growth, lipase activity, and tyrosine metabolism. CEA proteins can be targeted by antibodies for research purposes in the life sciences field. Monoclonal antibodies such as trastuzumab can specifically bind to CEA proteins and are commonly used in cancer treatment. Additionally, CEA proteins have been found to interact with other molecules such as lipoprotein lipase and growth factors, indicating their involvement in multiple cellular pathways. Researchers often rely on CEA proteins as valuable tools for studying growth hormone receptors, endothelial growth, and other important biological processes.

H-CYARAAARQARA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CYARAAARQARA-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CYARAAARQARA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CYARAAARQARA-OH at the technical inquiry form on this page

Mouse monoclonal Moesin antibody

Gly-Gly-NH2·HCl is a nanosized antibiotic that has been shown to have antibacterial properties. It is activated by long-chain inorganic acids, such as hydrochloric acid, and organic solvents, such as acetone. This compound has an amide group that makes it acidic. The hydrocarbon chain of this molecule may be either short or long.

Disuccinimidyl selenodipropionate

Rabbit polyclonal AP2M1 antibody

Peptide H-FRALASL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FRALASL-NH2 include the following: Complementary peptides that interfere with platelet aggregation and adherence TK Gartner, DB Taylor, J Derrick - Immunomethods, 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1058668784710497 A naturally occurring mutation near the amino terminus of alphaIIb defines a new region involved in ligand binding to alphaIIbbeta3 RB Basani, DL French, G Vilaire - Blood, The Journal , 2000 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/95/1/180/180808 alphaIIbbeta3-mediated outside-in signaling induced by the agonist peptide LSARLAF utilizes ADP and thromboxane A2 receptors to cause alpha-granule secretion by MJ Cho, J Liu , TI Pestina, SA Steward - Journal of Thrombosis , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1538783622147045 Distinct domains of alphaIIbbeta3 support different aspects of outside-in signal transduction and platelet activation induced by LSARLAF, an alphaIIbbeta3 interacting peptide JM Derrick, SJ Shattil, M Poncz - Thrombosis and , 2001 - thieme-connect.comhttps://www.thieme-connect.com/products/ejournals/html/10.1055/s-0037-1616147 Peptide LSARLAF activates alphaIIbbeta3 on resting platelets and causes resting platelet aggregate formation without platelet shape change JM Derrick, RG Loudon, TK Gartner - Thrombosis research, 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0049384897002892 Characterization of a unique synthetic peptide which acts as a platelet agonist reveals evidence supporting novel integrin functions JM Derrick - 1997 - search.proquest.comhttps://search.proquest.com/openview/bc4ed565f06717fe132297c6890f3472/1?pq-origsite=gscholar&cbl=18750&diss=y The beta3 subunit of the integrin alphaIIbbeta3 regulates alphaIIb-mediated outside-in signaling J Liu , CW Jackson, RA Gruppo, LK Jennings - Blood, 2005 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/105/11/4345/19508 Peptide LSARLAF induces integrin beta3 dependent outside-in signaling in platelets H Niu , Z Xu, D Li , L Zhang, K Wang, DB Taylor, J Liu - Thrombosis research, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0049384812001302 Protein disulfide isomerase and sulfhydryl-dependent pathways in platelet activation DW Essex , M Li, A Miller, RD Feinman - Biochemistry, 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi002454e The heptapeptide LSARLAF mediates platelet activation through phospholipase Cgamma2 independently of glycoprotein IIb-IIIa AC Pearce, P Wonerow, SJ Marshall - Biochemical , 2004 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/378/1/193/41044

Mouse monoclonal IgG2b Isotype Control Fc fusion protein

Aryl hydrocarbon receptor (AhR) agonist

Rabbit polyclonal eNOS antibody (Thr494)

Mouse monoclonal NGAL antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TSHR antibody, catalog no. 70R-6004

Mouse monoclonal ACAT2 antibody

Peptide H-SFEDIHHYREQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFEDIHHYREQIK^-OH include the following: Quantifying KRAS G12C covalent drug inhibitor activity in mouse tumors using mass spectrometry JC Tran , T Hunsaker, C Bell, TP Ma, E Chan - Analytical , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.2c04417

CDC42EP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HVGRGGDAFGDTSFLSRHGGGPPPEPRAPPAGAPRSPPPPAVPQSAAPSP

Purified recombinant Human ANXA13 protein

Purified recombinant Human CCNB1 Protein (His tag)

Cyclin E2 antibody was raised in rabbit using residues 2-15 [SRRSSRLQAKQQPQC] of the Cyclin E2 protein as the immunogen.

Rabbit polyclonal PPAPDC3 antibody

H-GDVFVIREPFISCSH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GDVFVIREPFISCSH-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GDVFVIREPFISCSH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GDVFVIREPFISCSH-OH at the technical inquiry form on this page

PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG

Purified Polyclonal POLR3F antibody

SCF protein is a ubiquitin ligase that plays a crucial role in the regulation of protein degradation. It can be used in various research applications, including studying protein-protein interactions and identifying potential therapeutic targets. The SCF protein can be detected using a monoclonal antibody that specifically recognizes it. This antibody can be used in assays such as immunoprecipitation or Western blotting to detect and quantify SCF protein levels in different samples. Additionally, the SCF protein has been shown to have neutralizing effects on TGF-β1, a growth factor involved in various cellular processes. This makes the SCF protein a valuable tool for studying the role of TGF-β1 in different biological systems. The SCF protein is available as a recombinant form, which ensures high purity and activity. It can be used in conjunction with other proteins or antigens to study their interactions or functional effects. Overall, the SCF protein is an essential reagent for researchers working in life

COVID-19 Nucleocapsid recombinant antigen