Biochemicals and Reagents

Purified Polyclonal ZAP70 antibody

Rat monoclonal NGAL antibody (Biotin)

KDM5A antibody was raised in Rabbit using Human KDM5A as the immunogen

Purified recombinant Human VRK3 Protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTN2 antibody, catalog no. 70R-2259

PF-07104091 is a peptide that can activate the immune system by binding to an antibody. It is a research tool for use in cell biology, pharmacology, and immunology. PF-07104091 has been shown to inhibit the function of ion channels and receptors. This drug can also be used as a ligand in protein interactions and as an inhibitor of protein interactions.

3,4,6-Tri-O-benzyl-1,2-O-(1-methoxyethylidene)-β-D-mannopyranose

SMUG1 antibody was raised using the middle region of SMUG1 corresponding to a region with amino acids IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Peptide H-GPAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GPAGPQGPR^-OH include the following: Effect of ultrasound power on extraction kinetic model, and physicochemical and structural characteristics of collagen from chicken lung Y Zou, H Yang, X Zhang, P Xu, D Jiang - Processing and Nutrition, 2020 - Springerhttps://link.springer.com/article/10.1186/s43014-019-0016-1 Protein digestomic analysis reveals the bioactivity of deer antler velvet in simulated gastrointestinal digestion Y Yu, Y Jin , F Wang , J Yan, Y Qi, M Ye - Food research international, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0963996917301515 A novel antioxidant iron-chelating peptide from yak skin: analysis of the chelating mechanism and digestion stability in vitro X Ci, R Liu, Y Sun, M Rifky , R Liu , Y Jin - Journal of the , 2024 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jsfa.13621 Determination and quantification of collagen types in tissues using HPLC-MS/MS S Pataridis, A Eckhardt, K Mikulikova - Current analytical , 2009 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cac/2009/00000005/00000004/art00004 Fortification of yogurt with oyster hydrolysate and evaluation of its in vitro digestive characteristics and anti-inflammatory activity L Liu, S Jiang, W Xie, J Xu, Y Zhao, M Zeng - Food Bioscience, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212429221005976 of low molecular weight peptides of E-Jiao on chemotherapy-induced myelosuppression: evaluation of pharmacological activity and identification of bioactive peptides J Zhang, D Lin, Y Wu, L Chen, Z Ma, M Wu - Frontiers in , 2024 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fphar.2024.1366407/full Assessing the extent of bone degradation using glutamine deamidation in collagen J Wilson , NL van Doorn, MJ Collins - Analytical chemistry, 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac301333t Evaluating the Degradation Process of Collagen Sponge and Acellular Matrix Implants In Vivo Using the Standardized HPLC-MS/MS Method J Gao, Y Ma, Z Guo, Y Zhang, F Xing, T Zhang, Y Kong - Separations, 2023 - mdpi.comhttps://www.mdpi.com/2297-8739/10/1/47 UHPLC/ESI-Q-TOF-HRMS Analysis for Identification of Collagen Hydrolysates Produced from White Shavings by Locally Isolated Bacterial Strains H Elsayed, M Marzouk, AMS Ismail - Egyptian Journal of , 2024 - ejchem.journals.ekb.eghttps://ejchem.journals.ekb.eg/article_340097.html

Rabbit polyclonal RGS13 antibody

TNFSF13B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

BAY 1316957 is a drug that inhibits the enzyme glucuronidation. It is being investigated for the treatment of cancer and neurodegenerative diseases. BAY 1316957 has been shown to inhibit endometriotic lesions in the pelvic cavity, as well as expressed endometriosis. This drug has also been shown to have an anti-nociceptive effect in animal models of cancer. The pharmacokinetic properties of BAY 1316957 have been optimized by altering its receptor subtype.

Recombinant E.coli coaA protein (His tag)

Caffeine-d3 is a cell-permeable analogue of caffeine that can be used as an internal standard for the quantification of caffeine in mammalian cells. Caffeine-d3 may also be used to measure the elimination rate of caffeine from animal tissues and to study the effect of matrix components on drug uptake. It may also be used to study the activity of hydroxyzine and theophylline, which is due to their structural similarity with caffeine. Caffeine-d3 is a fatty acid that can act as a cellular messenger through activation or inhibition of adenosinergic receptors.

Please enquire for more information about CDK7-IN-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Tyr-3/Trp- 5 Monooxygenase Activation Protein Zeta (TAZ) is an enzyme that is involved in the regulation of cellular proliferation, differentiation and apoptosis. This protein contains a domain with high similarity to the Tyr-3/Trp-5 monooxygenase activation domain and has been shown to be an activator of this enzyme. TAZ also interacts with ion channels and has been shown to inhibit their function. TAZ is a recombinant human protein produced in E. coli cells and purified by a proprietary process that yields a high purity product.

Peptide LCBiot-YLGR-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-YLGR-CMK include the following: Methods for mapping protease specificity SL Diamond - Current Opinion in Chemical Biology, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1367593106001852 Interaction of graphene with out-of-plane aromatic hydrocarbons SK Kolev , HA Aleksandrov , VA Atanasov - The Journal of , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jpcc.9b03550 Prolonged sleep deprivation induces a cytokine-storm-like syndrome in mammals D Sang , K Lin, Y Yang, G Ran, B Li , C Chen, Q Li , Y Ma - Cell, 2023 - cell.comhttps://www.cell.com/cell/pdf/S0092-8674(23)01176-5.pdf

Mouse monoclonal UBL4A antibody

Region of GCSF protein corresponding to amino acids TPLGPASSLP QSFLLKCLEQ VRKIQGDGAA LQEKLCATYK LCHPEELVLL GHSLGIPWAP LSSCPSQALQ LAGCLSQLHS GLFLYQGLLQ ALEGISPELG PTLDTLQLDV ADFATTIWQQ MEELGMAPAL QPTQGAMPAF ASAFQRRAGG VLVASHLQSF LEVSYRVLRH LAQP.

A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD6 antibody, catalog no. 70R-1505

GIT2 antibody was raised in rabbit using the C terminal of GIT2 as the immunogen

Porcine TRY(Trypsin) ELISA Kit

Peptide 5TAMRA-R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using 5TAMRA-R-OH include the following: Quantitative structure-activity relationship study of antioxidative peptide by using different sets of amino acids descriptors YW Li , B Li, J He, P Qian - Journal of Molecular Structure, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S002228601100384X Conjugation of a photosensitizer to an oligoarginine-based cell-penetrating peptide increases the efficacy of photodynamic therapy Y Choi , JR McCarthy, R Weissleder - ChemMedChem , 2006 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cmdc.200500036 Role of peptide hydrophobicity in the mechanism of action of alpha-helical antimicrobial peptides Y Chen , MT Guarnieri , AI Vasil, ML Vasil - Antimicrobial agents , 2007 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/aac.00925-06 Peptide modifications differentially alter G protein-coupled receptor internalization and signaling bias V Made, S Babilon, N Jolly, L Wanka - Angewandte Chemie , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/anie.201403750 Systemic in vivo distribution of activatable cell penetrating peptides is superior to that of cell penetrating peptides TA Aguilera , ES Olson, MM Timmers, T Jiang - Integrative , 2009 - academic.oup.comhttps://academic.oup.com/ib/article-abstract/1/5-6/371/5211408 C-end rule peptides mediate neuropilin-1-dependent cell, vascular, and tissue penetration T Teesalu , KN Sugahara - Proceedings of the , 2009 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0908201106 Concomitant Occurrence of Peptide 310- and alpha-Helices Probed by NMR S Mammi, M Rainaldi, M Bellanda - Journal of the , 2000 - ACS Publicationshttps://pubs.acs.org/doi/full/10.1021/ja002710a Stearylated arginine-rich peptides: a new class of transfection systems S Futaki, W Ohashi, T Suzuki, M Niwa - Bioconjugate , 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc015508l Arginine-rich peptides: an abundant source of membrane-permeable peptides having potential as carriers for intracellular protein delivery S Futaki, T Suzuki, W Ohashi, T Yagami - Journal of Biological , 2001 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)46333-3/abstract Translocation of branched-chain arginine peptides through cell membranes: flexibility in the spatial disposition of positive charges in membrane-permeable peptides S Futaki, I Nakase, T Suzuki, Zhang , Y Sugiura - Biochemistry, 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0256173 Cell-surface interactions on arginine-rich cell-penetrating peptides allow for multiplex modes of internalization S Futaki, I Nakase - Accounts of chemical research, 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.accounts.7b00221 Arginine-rich peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms S Futaki - International journal of pharmaceutics, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S037851730200337X Arginine-rich cell penetrating peptides: Design, structure-activity, and applications to alter pre-mRNA splicing by steric-block oligonucleotides R Abes, A Arzumanov, H Moulton - European Peptide , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.979 Exploring the sequence space for (tri-) peptide self-assembly to design and discover new hydrogels PWJM Frederix , GG Scott, YM Abul-Haija - Nature , 2015 - nature.comhttps://www.nature.com/articles/nchem.2122 Design, synthesis, and evaluation of amphiphilic cyclic and linear peptides composed of hydrophobic and positively-charged amino acids as antibacterial agents N Riahifard, S Mozaffari , T Aldakhil, F Nunez - Molecules, 2018 - mdpi.comhttps://www.mdpi.com/1420-3049/23/10/2722 Selective amino acid substitution reduces cytotoxicity of the antimicrobial peptide mastoparan LN Irazazabal, WF Porto , SM Ribeiro , S Casale - et Biophysica Acta (BBA , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005273616302449 Synthesis and application of unprotected cyclic peptides as building blocks for peptide dendrimers L Zhang, JP Tam - Journal of the American Chemical Society, 1997 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja9621105 Molecular transporters for peptides: delivery of a cardioprotective ϵPKC agonist peptide into cells and intact ischemic heart using a transport system, R7 L Chen, LR Wright, CH Chen, SF Oliver, PA Wender - Chemistry & biology, 2001 - cell.comhttps://www.cell.com/ccbio/pdf/S1074-5521(01)00076-X.pdf Antibacterial activities of ferrocenoyl-and cobaltocenium-peptide bioconjugates JT Chantson, MVV Falzacappa, S Crovella - Journal of , 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022328X05005243 Effects of cargo molecules on the cellular uptake of arginine-rich cell-penetrating peptides JR Maiolo, M Ferrer , EA Ottinger - Biochimica et Biophysica Acta (BBAhttps://www.sciencedirect.com/science/article/pii/S0005273605001094 Peptide synthesis using unprotected peptides through orthogonal coupling methods. JP Tam , YIAN Lu, CFA Liu - Proceedings of the , 1995 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.92.26.12485 ω-Amino acids in peptide design. Crystal structures and solution conformations of peptide helices containing a beta-alanyl-γ-aminobutyryl segment IL Karle, A Pramanik , A Banerjee - Journal of the , 1997 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja970566w A helix-stabilized cell-penetrating peptide as an intracellular delivery tool H Yamashita, M Oba , T Misawa, M Tanaka - , 2016 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.201500468 Sequence-specific Ni (II)-dependent peptide bond hydrolysis for protein engineering: reaction conditions and molecular mechanism E Kopera, A Krezel , AM Protas, A Belczyk - Inorganic , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ic1005709 Neuroprotective peptides fused to arginine-rich cell penetrating peptides: Neuroprotective mechanism likely mediated by peptide endocytic properties BP Meloni , D Milani, AB Edwards , RS Anderton - Pharmacology & , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0163725815001175 Selective peptide bond hydrolysis of cysteine peptides in the presence of Ni (II) ions AM Protas, A Bonna , E Kopera, W Bal - Journal of inorganic biochemistry, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0162013410002175 Prediction of peptide retention at different HPLC conditions from multiple linear regression models , M MarszaÅ‚Å‚ , YV Heyden , R Kaliszan - Journal of Proteome , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr049780r

Tulobuterol is a drug used as a bronchodilator for the treatment and management of asthma and COPD. This drug is a long acting beta-2 adrenergic receptor agonist. Tulobuterol HCl is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

H-GCTLNFPISPIETVP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GCTLNFPISPIETVP-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GCTLNFPISPIETVP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GCTLNFPISPIETVP-OH at the technical inquiry form on this page

SeramunGelb fast

Purified recombinant POLR3K protein (His tag)

Peptide 5Fam-CRGDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using 5Fam-CRGDK-OH include the following: Internalizing RGD, a great motif for targeted peptide and protein delivery: a review article Z Davoodi, F Shafiee - Drug Delivery and Translational Research, 2022 - Springerhttps://link.springer.com/article/10.1007/s13346-022-01116-7 Tumor-targeting peptide for redox-responsive Pt prodrug and gene codelivery and synergistic cancer chemotherapy Y Bai, Z Li, L Liu, T Sun, X Fan, T Wang - ACS Applied Bio , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsabm.9b00065 Increased antitumor activity of tumor-specific peptide modified thymopentin X Lao, B Li, M Liu, J Chen, X Gao, H Zheng - Biochimie, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0300908414002624 Does ligand-receptor mediated competitive effect or penetrating effect of iRGD peptide when co-administration with iRGD-modified SSL? WQ Zhang, KF Yu, T Zhong , LM Luo, R Du - Journal of drug , 2015 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.3109/1061186X.2015.1034279 Peptide-functionalized delivery vehicles for enhanced cancer therapy SY Tang, H Wei, CY Yu - International Journal of Pharmaceutics, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378517320311261 Peptide-mediated cancer targeting of nanoconjugates S Raha , T Paunesku - Wiley Interdisciplinary , 2011 - Wiley Online Libraryhttps://wires.onlinelibrary.wiley.com/doi/abs/10.1002/wnan.121 Neuropilin-1 Binding Peptide as Fusion to Diphtheria Toxin Induces Apoptosis in Non-small Cell Lung Cancer Cell Line S Eghtedari, M Behdani - Current , 2024 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cpd/2024/00000030/00000017/art00003 Developments in tumor targeting and internalizing peptides RIC Padanha - 2017 - repositorio.ul.pthttps://repositorio.ul.pt/handle/10451/36085 Peptide-based nanoprobes for molecular imaging and disease diagnostics P Zhang , Y Cui, CF Anderson , C Zhang, Y Li - Chemical Society , 2018 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2018/cs/c7cs00793k Homing peptides for cancer therapy P Lingasamy , T Teesalu - Bio-nanomedicine for cancer therapy, 2021 - Springerhttps://link.springer.com/chapter/10.1007/978-3-030-58174-9_2 Tumor penetrating peptide-functionalized tenascin-C antibody for glioblastoma targeting P Lingasamy , AH Laarmann - Current cancer drug , 2021 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ccdt/2021/00000021/00000001/art00006 A versatile theranostic nanodevice based on an orthogonal bioconjugation strategy for efficient targeted treatment and monitoring of triple negative breast cancer MV Cano-Cortes , SA Navarro-Marchal - , Biology and Medicine, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1549963419302047 Peptide-modified nanoparticles for tumor targeting and molecular imaging L Lu, Q Zhang, Z Wang, L Gao - Current Medicinal , 2021 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cmc/2021/00000028/00000031/art00009 De Novo Design of a Tumor-Penetrating Peptide L Alberici, L Roth, KN Sugahara, L Agemy - Cancer research, 2013 - AACRhttps://aacrjournals.org/cancerres/article-abstract/73/2/804/590737 Proapoptotic peptide-mediated cancer therapy targeted to cell surface p32 L Agemy, VR Kotamraju, D Friedmann-Morvinski - Molecular Therapy, 2013 - cell.comhttps://www.cell.com/molecular-therapy-family/molecular-therapy/fulltext/S1525-0016(16)30945-5 Tissue-penetrating delivery of compounds and nanoparticles into tumors KN Sugahara, T Teesalu , PP Karmali, VR Kotamraju - Cancer cell, 2009 - cell.comhttps://www.cell.com/cancer-cell/pdf/S1535-6108(09)00382-1.pdf A tumor-penetrating peptide enhances circulation-independent targeting of peritoneal carcinomatosis KN Sugahara, P Scodeller , GB Braun - Journal of Controlled , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365915006161 Cell-Penetrating Peptide-Conjugated BF2-Oxasmaragdyrins as NIRF Imaging and Photothermal Agents K Laxman , BPK Reddy , A Robinson - , 2020 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cmdc.202000401 Use of Chitosan from Southern King Crab to Develop Films Functionalized with RGD Peptides for Potential Tissue Engineering Applications JC Forero , K Carvajal, F Guzman, C Acevedo, N Osses - Biomimetics, 2023 - mdpi.comhttps://www.mdpi.com/2313-7673/8/3/323 Integrin-targeting peptides for the design of functional cell-responsive biomaterials J Zhao, F Santino, D Giacomini, L Gentilucci - Biomedicines, 2020 - mdpi.comhttps://www.mdpi.com/2227-9059/8/9/307 Theranostic iRGD peptide containing cisplatin prodrug: Dual-cargo tumor penetration for improved imaging and therapy HJ Cho , SJ Park, YS Lee , S Kim - Journal of controlled release, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365919301269 Activatable iRGD-based peptide monolith: Targeting, internalization, and fluorescence activation for precise tumor imaging HJ Cho , SJ Lee, SJ Park, CH Paik, SM Lee - Journal of Controlled , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365916304096 A free cysteine prolongs the half-life of a homing peptide and improves its tumor-penetrating activity HB Pang , GB Braun , ZG She , VR Kotamraju - Journal of Controlled , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365913009486 iRGD: a promising peptide for cancer imaging and a potential therapeutic agent for various cancers H Zuo - Journal of Oncology, 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2019/9367845 Peptide-decorated polymeric nanomedicines for precision cancer therapy H Sun , Y Dong, J Feijen , Z Zhong - Journal of controlled release, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365918305686 Acid-responsive PEGylated doxorubicin prodrug nanoparticles for neuropilin-1 receptor-mediated targeted drug delivery H Song, J Zhang, W Wang , P Huang, Y Zhang - Colloids and Surfaces B , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0927776515301995 Amphipathic tail-anchoring peptide is a promising therapeutic agent for prostate cancer treatment G De, JK Ko , T Tan, H Zhu , H Li , J Ma - Oncotarget, 2014 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4202157/ CRGDK-functionalized PAMAM-based drug-delivery system with high permeability D Liu, C Wang, J Yang, Y An, R Yang, G Teng - ACS omega, 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsomega.0c00202 Targeted modification of the cationic anticancer peptide HPRP-A1 with iRGD to improve specificity, penetration, and tumor-tissue accumulation C Hu, Y Huang, Y Chen - Molecular Pharmaceutics, 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.molpharmaceut.8b00854 Nrp-1 receptor targeting peptide-functionalized TPGS micellar nanosystems to deliver 10-hydroxycampothecin for enhanced cancer chemotherapy A Mozhi , I Ahmad , QM Kaleem, RG Tuguntaev - International journal of , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378517318303880 Gold nanoparticles functionalized with therapeutic and targeted peptides for cancer treatment A Kumar , H Ma, X Zhang , K Huang, S Jin , J Liu , T Wei - Biomaterials, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961211012622 Peptide-based strategies for targeted tumor treatment and imaging A Ayo, P Laakkonen - Pharmaceutics, 2021 - mdpi.comhttps://www.mdpi.com/1999-4923/13/4/481

CD62L antibody (FITC) was raised in rat using C3H/eb cloned murine B lymphoma 39C-13 as the immunogen.

Tobramycin

Nesfatin-1 (30-59) is a peptide that is isolated from the brain and has been shown to have the ability to regulate feeding behavior. It is thought to be involved in the regulation of appetite and body weight. Nesfatin-1 (30-59) has been shown to inhibit ghrelin secretion, which is a hormone involved in hunger and satiety. This peptide also appears to stimulate insulin secretion by pancreatic beta cells, which may contribute to its anti-diabetic effects.

Purified Polyclonal NUR77 antibody

1,2:5,6-Di-O-isopropylidene-?-D-ribo-hexofuranos-3-ulose

GDNF antibody was raised in rabbit using highly pure recombinant human GDNF as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of KHDRBS3 antibody, catalog no. 70R-4610

MCM8 antibody was raised using the C terminal of MCM8 corresponding to a region with amino acids IRLTEARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQH

A synthetic peptide for use as a blocking control in assays to test for specificity of FZD9 antibody, catalog no. 70R-7131

Mouse monoclonal TAL1 antibody

H-LHYFNAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LHYFNAR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LHYFNAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LHYFNAR-OH at the technical inquiry form on this page

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Epitope of TNF alpha

KLHL22 antibody was raised in rabbit using the N terminal of KLHL22 as the immunogen

SSTC3 is a recombinant protein that inhibits the PI3K/Akt pathway. This pathway, which is involved in regulating cell proliferation, is often activated by cancer stem cells. The inhibition of this pathway leads to the death of cancer cells and can be used for the treatment of cancers, such as brain cancer. SSTC3 has been shown to be effective against human tumor cells in vitro and in vivo. In addition, SSTC3 has also been shown to reduce the incidence of diabetes mellitus type 2 in diabetic patients by its ability to inhibit insulin resistance. Clinical data on SSTC3 is limited but promising.

Please enquire for more information about Cystatin C antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

MYO1E antibody was raised in Rabbit using Human MYO1E as the immunogen

Methyltetrazine agarose is a 6% crosslinked agarose resin that is activated with methyltetrazine functional groups for covalent immobilization of TCO-modified biomolecules via a Diels-Alder  reaction. Applications are preparation of protein agarose media with almost quantitative capture of proteins. Activation level: 10-20 µmol methyltetrazine groups per mL resin Bead size: 50-150 µm

A synthetic peptide for use as a blocking control in assays to test for specificity of Utx antibody, catalog no. 70R-7989

ELISA kit for the detection of Parietal Cell in the research laboratory

MS 245 Oxalate is a high purity ligand for research purposes. It is used in Cell Biology to study protein interactions and as an inhibitor in Peptides. MS 245 Oxalate has been shown to activate Ion channels, which may be useful for the treatment of epilepsy.

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ44894 antibody, catalog no. 70R-8899

Donkey anti-goat IgG was raised in donkey using goat IgG (H & L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HSF1 antibody, catalog no. 20R-1123

PLA2G3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Coagulation Factor X ELISA kit for the detection of Factor X in the research laboratory

Rabbit Polyclonal JunB antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TTC27 antibody, catalog no. 70R-9467

Purified recombinant PSG1 protein (His tag)

Armenian Hamster monoclonal CCR5 antibody (PE)

EBV VCA and EBNA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV VCA and EBNA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Purified recombinant HES7 protein

HIV1 gp41 antibody was raised in mouse using purified HIV1 envelope gp41 as the immunogen.

H-TVTTSGTTDNTVTPTSQPVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TVTTSGTTDNTVTPTSQPVR-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TVTTSGTTDNTVTPTSQPVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TVTTSGTTDNTVTPTSQPVR-OH at the technical inquiry form on this page

Canine Coronavirus Nucleocapsid Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Canine Coronavirus Nucleocapsid Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Please enquire for more information about MEISi-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page

CDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDRED

The ME™ Kit is used for specific isolation of extracellular vesicles (exosomes, microvesicles) in as little as 45 minutes using a standard bench top centrifuge. This product is optimized for urine or media samples and contains the 1mg Vn96 peptide (enough for 20x samples), 500µl ME buffer, a negative control (100µg Vn96 scrambled peptide) and 50µl purified exosomes from HEK293 cells as positive control.Extracellular vesicle isolation, is becoming essential in diagnostics and therapeutics. These small membrane-enclosed particles play important roles in many biological processes, including communication, immune response, tissue regeneration, and tumor progression. They are also being studied for their use as biomarkers for various diseases and as potential therapeutics against cancer, neurodegenerative disorders, and inflammatory conditions. It is becoming known that blood profiling alongside exosome analysis provides scientists with suitable resources to monitor disease progression. To combat the challenges associated with exosome isolation Cymit Quimica have developed two ME™ Kits, available for purchase online based on optimization for how different sample types behave: urine or media samples (ME-020) and plasma samples (ME-020P). Our technique produces results comparable to ultracentrifugation, but at much greater efficiency as 1/30th the sample size is required, fulfilling the needs of the diagnostic and pharma industries.   The underlaying mechanisms of how the kit works - an affinity for canonical HSPs - may allow for this to be applied fairly broadly, since HSPs are roundly conserved from bacteria to higher order mammals.For more information on the effectiveness and flexibility of this extracellular isolation technology read our publication (Gosh, 2014).

Mouse monoclonal SLC2A5 antibody

Purified recombinant CXCL5 protein (Mouse) (His tag)

H-GGGVLVQPG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GGGVLVQPG-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GGGVLVQPG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GGGVLVQPG-OH at the technical inquiry form on this page

Rabbit anti-mouse kappa chain (HRP) was raised in rabbit using murine kappa light chain as the immunogen.

Peptide H-TETSQVAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TETSQVAPA-OH include the following: Comprehensive insulin receptor phosphorylation dynamics profiled by mass spectrometry Z Liao, C Zhang, L Ding, JS Moyers, JX Tang - The FEBS , 2022 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.16299 Efficient expression and immunoaffinity purification of human trace amine-associated receptor 5 from E. coli cell-free system X Wang, Y Cui, J Wang - Protein and Peptide Letters, 2013 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ppl/2013/00000020/00000004/art00012 T4-Lysozyme Fusion for the Production of Human Formyl Peptide Receptors for Structural Determination X Wang, Y Cui, J Wang - Applied biochemistry and biotechnology, 2014 - Springerhttps://link.springer.com/article/10.1007/s12010-013-0704-2 Production of a bioengineered G-protein coupled receptor of human formyl peptide receptor 3 X Wang, S Zhang - Plos one, 2011 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0023076 Study of two G-protein coupled receptor variants of human trace amine-associated receptor 5 X Wang, K Corin, C Rich, S Zhang - Scientific reports, 2011 - nature.comhttps://www.nature.com/articles/srep00102 Evaluation of cell-free expression system for the production of soluble and functional human GPCR N-formyl peptide receptors X Wang, J Wang , B Ge - Protein and Peptide Letters, 2013 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ppl/2013/00000020/00000011/art00012 Structural and functional alterations associated with deutan N94K and R330Q mutations of green cone opsin S Srinivasan , MA Fernandez-Sampedro - et Biophysica Acta (BBA , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0925443917301436 Beyond spectral tuning: human cone visual pigments adopt different transient conformations for chromophore regeneration S Srinivasan , A Cordomaca­ , E Ramon - Cellular and molecular life , 2016 - Springerhttps://link.springer.com/article/10.1007/s00018-015-2043-7 Structural basis for GABAA receptor potentiation by neurosteroids PS Miller , S Scott, S Masiulis, L De Colibus - Nature structural & , 2017 - nature.comhttps://www.nature.com/articles/nsmb.3484 Crystal structure of a human GABAA receptor PS Miller , AR Aricescu - Nature, 2014 - nature.comhttps://www.nature.com/articles/nature13293 Capture and reconstitution of G protein-coupled receptors on a biosensor surface P Stenlund, GJ Babcock, J Sodroski, DG Myszka - Analytical biochemistry, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269703000460 Role of the C terminus of the photoreceptor ABCA4 transporter in protein folding, function, and retinal degenerative diseases M Zhong, LL Molday, RS Molday - Journal of biological chemistry, 2009 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)81778-7/abstract Efficient cell-free production of olfactory receptors: detergent optimization, structure, and ligand binding analyses L Kaiser, J Graveland-Bikker - Proceedings of the , 2008 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0804766105 Glycine-rich transmembrane helix 10 in the staphylococcal tetracycline transporter TetA (K) lines a solvent-accessible channel KA Hassan , KL Robinson, AN Smith, JH Gibson - Biochemistry, 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0614380 # Protein Lights Up in Cryo-EM JZ Chen - Microscopy and Microanalysis, 2019 - cambridge.orghttps://www.cambridge.org/core/journals/microscopy-and-microanalysis/article/protein-lights-up-in-cryoem/EC71BDB367E875252BF04C545DC3DFB7 Constitutive association of cell surface CCR5 and CXCR4 in the presence of CD4 J Wang, R Alvarez , G Roderiquez - Journal of cellular , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jcb.20161 Absolute quantification of the G protein-coupled receptor rhodopsin by LC/MS/MS using proteolysis product peptides and synthetic peptide standards DR Barnidge, EA Dratz , T Martin, LE Bonilla - Analytical , 2003 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac026154+ Improvements in G protein-coupled receptor purification yield light stable rhodopsin crystals D Salom , I Le Trong, E Pohl, JA Ballesteros - Journal of structural , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1047847706001675 Expression of glucagon receptors in tetracycline-inducible HEK293S GnT1-stable cell lines: An approach toward purification of receptor protein for structural studies CG Unson - Peptide Science, 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.20951 Study of a synthetic human olfactory receptor 17-4: expression and purification from an inducible mammalian cell line BL Cook, KE Ernberg, H Chung, S Zhang - PloS one, 2008 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0002920 Large-scale production and study of a synthetic G protein-coupled receptor: human olfactory receptor 17-4 BL Cook, D Steuerwald, L Kaiser - Proceedings of the , 2009 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0811089106 Homogeneous time-resolved fluorescence assay to probe folded G protein-coupled receptors AM Knepp, TP Sakmar , T Huber - Methods in enzymology, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780124078659000108 In vitro reconstitution and preparative purification of complexes between the chemokine receptor CXCR4 and its ligands SDF-1alpha, gp120-CD4 and AMD3100 A Dukkipati , J Vaclavikova, D Waghray - Protein expression and , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592806002270

Purified Turkey IgG FITC conjugate

Mouse monoclonal RASD2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM8 antibody, catalog no. 70R-5553

Purified Rabbit polyclonal MBL2 antibody

Peptide H-VRIGHLYIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VRIGHLYIL-OH include the following: CRISPR/Cas9 screening reveals a distinct class of MHC-I binders with precise HLA-peptide recognition TAW Schoufour, A van der Plas-van Duijn, I Derksen- iScience, 2024 - cell.comhttps://www.cell.com/iscience/fulltext/S2589-0042(24)01345-2 Characterization and clinical enrichment of HLA-C*07:02-restricted Cytomegalovirus-specific CD8+ T cells F Schlott, D Steubl, S Ameres, A Moosmann, S Dreher- PloS one, 2018 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0193554 Presentation of a conserved adenoviral epitope on HLA-C* 0702 allows evasion of natural killer but not T cell responses A Keib, PS Günther , B Faist, A Halenius- Viral ..., 2017 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2016.0145 Ex vivo screening for immunodominant viral epitopes by quantitative real time polymerase chain reaction (qRT-PCR) M Provenzano , S Mocellin, P Bonginelli- Journal of Translational ..., 2003 - Springerhttps://link.springer.com/article/10.1186/1479-5876-1-12 Clinical and immunological evaluation of patients with metastatic melanoma undergoing immunization with the HLA-Cw* 0702-associated epitope MAGE-A12: 170 MP Bettinotti , MC Panelli, E Ruppe- journal of cancer, 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.11045 Unmasking cryptic epitopes after loss of immunodominant tumor antigens through epitope spreading KM Lally - 2002 - elischolar.library.yale.eduhttps://elischolar.library.yale.edu/cgi/viewcontent.cgi?article=2824&context=ymtdl Unmasking cryptic epitopes after loss of immunodominant tumor antigen expression through epitope spreading KM Lally , S Mocellin, GA Ohnmacht- journal of cancer, 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.1420 Cytolytic T lymphocytes raised against a human bladder carcinoma recognize an antigen encoded by gene MAGE-A12 L Heidecker, F Brasseur, M Probst-Kepper- The Journal of ..., 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/164/11/6041/32509 A tumor-infiltrating lymphocyte from a melanoma metastasis with decreased expression of melanoma differentiation antigens recognizes MAGE-12 MC Panelli, MP Bettinotti , K Lally - The Journal of ..., 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/164/8/4382/32607 Cytolytic T Lymphocytes Raised Against a Human Bladder Carcinoma Recognize an Antigen Encoded by Gene... F Brasseur, M Probst-Kepper, TW Boon- 2000 - academia.eduhttps://www.academia.edu/download/51076430/Cytolytic_T_lymphocytes_raised_against_a20161227-11859-128ucll.pdf A Tumor-Infiltrating Lymphocyte from A Recognizes - J Immunol, 2000 - researchgate.nethttps://www.researchgate.net/profile/Francesco-Marincola-2/publication/12562727_A_Tumor-Infiltrating_Lymphocyte_from_a_Melanoma_Metastasis_with_Decreased_Expression_of_Melanoma_Differentiation_Antigens_Recognizes_MAGE-12/links/54487c4b0cf22b3c14e3113f/A-Tumor-Infiltrating-Lymphocyte-from-a-Melanoma-Metastasis-with-Decreased-Expression-of-Melanoma-Differentiation-Antigens-Recognizes-MAGE-12.pdf

Amitifadine is a small molecule that inhibits protein interactions and has been used as a research tool. It has been shown to bind to the extracellular domain of the beta-2 adrenergic receptor, which is responsible for binding with endogenous catecholamines such as epinephrine and norepinephrine. Amitifadine also binds to the alpha-1 adrenergic receptor, but not as strongly. This drug has also been shown to bind to other receptors such as the angiotensin II type 1 receptor, serotonin type 3A receptor, and histamine H1 receptor.

Purified recombinant Human PYCRL protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of GP9 antibody, catalog no. 70R-10332

rHuNOG

Rabbit polyclonal PIH1D1 antibody

H-IAIDLFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IAIDLFK-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IAIDLFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IAIDLFK-OH at the technical inquiry form on this page

Mouse monoclonal ACSS2 antibody