Biochemicals and Reagents

CD45 antibody was raised in Mouse using a purified recombinant fragment of CD45 expressed in E. coli as the immunogen.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Mouse monoclonal CD45RO antibody

PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL

FHL1 antibody was raised in Rabbit using Human Fhl1 as the immunogen

H-CGGLLAERKDKRN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGLLAERKDKRN-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGLLAERKDKRN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGLLAERKDKRN-OH at the technical inquiry form on this page

Hoxd13 antibody was raised in rabbit using the C terminal of Hoxd13 as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of U2AF2 antibody, catalog no. 70R-1354

Please enquire for more information about GSK 591 dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

PNU 74654 is a novel agent that has been shown to be active in cancer and other proliferative disorders. It inhibits the activity of cell signaling pathways by binding to and blocking the epidermal growth factor receptor, leading to reduced levels of cellular proliferation. In addition, PNU 74654 induces apoptosis in cancer cells by inhibiting transcriptional regulation and receptor activity. PNU 74654 also has antitumor effects on experimental models of breast cancer by inducing tumor cell lysis. The drug has been shown to be effective against a range of resistant breast cancer cells as well as various cancers tissues in rats.

TRAIL is a peptide that belongs to the group of cytokines. It activates the receptor-mediated apoptosis pathway in cells that have been stimulated by tumor necrosis factor-α (TNF-α) and other pro-inflammatory cytokines. TRAIL has also been shown to inhibit protein interactions, such as those between the TNF receptors and their ligands or receptors, like CD4. TRAIL also binds to the Fas receptor and its ligand, FasL, which leads to activation of caspases in a similar manner as FADD binding. The recombinant human TRAIL is a research tool for studying cell biology and pharmacology.

1-226 amino acids: MEGCVSNLMV CNLAYSGKLE ELKESILADK SLATRTDQDS RTALHWACSA GHTEIVEFLL QLGVPVNDKD DAGWSPLHIA ASAGRDEIVK ALLGKGAQVN AVNQNGCTPL HYAASKNRHE IAVMLLEGGA NPDAKDHYEA TAMHRAAAKG NLKMIHILLY YKASTNIQDT EGNTPLHLAC DEERVEEAKL LVSQGASIYI ENKEEKTPLQ VAKGGLGLIL KRMVEG

Purified Polyclonal Nephrocystin 5 antibody

Insulin II is a peptide hormone that is secreted by the beta cells of the pancreas. Insulin II regulates glucose metabolism, promotes protein synthesis and inhibits lipolysis. It can be used as a research tool to study protein interactions, activators and ligands, receptor binding and ion channel activity. Insulin II can also be used to generate monoclonal antibodies against insulin II. This product has the three code sequence: A-chain: Gly-Ile-Val-Asp-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn ; B-chain:Phe-Val-Lys-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Met-Ser, has the disulfide bonds: CysA6-CysA11, CysA7-CysB7, and CysA20-CysB19 and is available as a 50 µg vial.

A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS35 antibody, catalog no. 70R-5474

A synthetic peptide for use as a blocking control in assays to test for specificity of PRDM13 antibody, catalog no. 70R-8363

(2R)-2-[7-(4-Chlorophenyl)-5-methyl-2-[1-methyl-3-[1-(oxetan-3-yl)piperidin-4-yl]indazol-5-yl]-1,3-benzothiazol-6-yl]-2-[(2-methylpropan -2-yl)oxy]acetic acid is an inhibitor of Protein interactions, Activator, Ligand and a Research tool. It has High purity and is used in Life Sciences. CAS No. 2219362-41-9

ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Affinity purified Rabbit polyclonal SCG3 antibody

Peptide H-ACQGVGGPGHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ACQGVGGPGHK-OH include the following: BCL-2 antagonism sensitizes cytotoxic T cell-resistant HIV reservoirs to elimination ex vivo Y Ren, SH Huang , S Patel - The Journal of , 2020 - Am Soc Clin Investighttps://www.jci.org/articles/view/132374 De Novo Generation of Escape Variant-Specific CD8+ T-Cell Responses following Cytotoxic T-Lymphocyte Escape in Chronic Human Immunodeficiency Virus Type TM Allen , XG Yu , ET Kalife, LL Reyor - Journal of , 2005 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.79.20.12952-12960.2005 Identification of type-specific cytotoxic T lymphocyte responses to homologous viral proteins in laboratory workers accidentally infected with HIV-1. NV Sipsas , SA Kalams , A Trocha, S He - The Journal of , 1997 - Am Soc Clin Investighttps://www.jci.org/articles/view/119221 Full-length HIV type 1 genome analysis showing evidence for HIV type 1 transmission from a nonprogressor to two recipients who progressed to AIDS M Mikhail, B Wang, P Lemey , B Beckholdt - AIDS Research & , 2005 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.2005.21.575 Supplemental Table 1. List of HIV class I peptides. M End - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/ed0f/0f087694817c860c5aad97fab618403c2847.pdf HIV-1 NEF ligands predominate in the HLA class I of infected CD4+ T cells (APP2P. 108) J Yaciuk, S Smith , M Skaley, C McMurtrey - The Journal of , 2014 - journals.aai.orghttps://journals.aai.org/jimmunol/article/192/1_Supplement/43.9/53945 Different In Vivo Effects of HIV-1 Immunodominant Epitope-Specific Cytotoxic T Lymphocytes on Selection of Escape Mutant Viruses H Koizumi, M Hashimoto , M Fujiwara - Journal of , 2010 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.02483-09 Inhibition of major histocompatibility complex-I antigen presentation by sarbecovirus ORF7a proteins F Zhang, TM Zang, EM Stevenson - Proceedings of the , 2022 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.2209042119

Anti-Feline Leukemia Virus antibody

Peptide H-SQVTNPANI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SQVTNPANI-OH include the following: The T cell repertoire primed by antiviral vaccination is influenced by self-tolerance X Paliard, B Doe, CM Walker - Cellular immunology, 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0008874998913387 Structural requirements for the peptide-induced conformational change of free major histocompatibility complex class I heavy chains T Elliott, J Elvin, V Cerundolo, H Allen - European journal of , 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830220819 Infection of Human Dendritic Cells by SVRV Is - academia.eduhttps://www.academia.edu/download/40544383/Infection_of_Human_Dendritic_Cells_by_a_20151201-8803-16kdwyc.pdf Immune targeting of three independent suppressive pathways (TIGIT, PD-L1, TGFbeta) provides significant antitumor efficacy in immune checkpoint resistant models SE Franks, KP Fabian , G Santiago-Sanchez - , 2022 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/2162402X.2022.2124666 Role of non-anchor residues of Db-restricted peptides in class I binding and TCR triggering LJ Sigal , DE Wylie - Molecular immunology, 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589096000995 Infection of human dendritic cells by a sindbis virus replicon vector is determined by a single amino acid substitution in the E2 glycoprotein JP Gardner, I Frolov , S Perri, Y Ji - Journal of , 2000 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.74.24.11849-11857.2000 Kinetics of MHC-CD8 interaction at the T cell membrane J Huang , LJ Edwards , BD Evavold - The Journal of , 2007 - journals.aai.orghttps://journals.aai.org/jimmunol/article/179/11/7653/81167 Immunological targeting of tumor cells undergoing an epithelial-mesenchymal transition via a recombinant brachyury-yeast vaccine DH Hamilton, MT Litzinger, A Jales, B Huang - Oncotarget, 2013 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3858563/ Combination of docetaxel and recombinant vaccine enhances T-cell responses and antitumor activity: effects of docetaxel on immune enhancement CT Garnett , J Schlom, JW Hodge - Clinical Cancer Research, 2008 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/14/11/3536/72607 Rac GTPases play critical roles in early T-cell development C Dumont , A Corsoni-Tadrzak, S Ruf - Blood, The Journal , 2009 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/113/17/3990/25599 Concurrent vaccination with two distinct vaccine platforms targeting the same antigen generates phenotypically and functionally distinct T-cell populations AL Boehm, J Higgins, A Franzusoff, J Schlom - Cancer immunology , 2010 - Springerhttps://link.springer.com/article/10.1007/s00262-009-0759-7

LRPPRC antibody was raised in Rabbit using Human LRPPRC as the immunogen

Rabbit polyclonal FHIT antibody (biotin)

HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

CCDC42 antibody was raised in Rabbit using Human CCDC42 as the immunogen

Peptide Fluor-YGGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Fluor-YGGF-OH include the following: Condensation of Bioactive Compounds into the Membrane Compartment by Conjugation with Synthetic Polypeptides Y Imanishi, S Kimura - Biomimetic Polymers, 1990 - Springerhttps://link.springer.com/chapter/10.1007/978-1-4613-0657-3_11 Conformation-specific spectroscopy of peptide fragment ions in a low-temperature ion trap TN Wassermann, OV Boyarkin , B Paizs - Journal of the , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-012-0368-0 Enzymatic clickable functionalization of peptides via computationally engineered peptide amidase T Zhu, L Song, R Li, B Wu - Chinese Chemical Letters, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1001841718301414 Protection against dynorphin-(1-8) hydrolysis in membrane preparations by the combination of amastatin, captopril and phosphoramidon T Hiranuma, K Kitamura, T Taniguchi, M Kanai - of Pharmacology and , 1998 - ASPEThttps://jpet.aspetjournals.org/content/286/2/863.short Almost complete protection from [Met5]-enkephalin-Arg6-Gly7-Leu8 (Met-enk-RGL) hydrolysis in membrane preparations by the combination of amastatin, captopril T Hiranuma, K Iwao, K Kitamura, T Matsumiya - Journal of Pharmacology , 1997 - ASPEThttps://jpet.aspetjournals.org/content/281/2/769.short A One-Bead One-Peptide Combinatorial Library Method for B-Cell Epitope Mapping NF Sepetov, M Leblaca­ - 1996 - 5z.comhttp://www.5z.com/mlebl/publications/1996Methods_482.pdf Modification of capillary electrophoresis selectivity in hydro-organic solutions: dissociation constants and Stokes radius measurements of peptides in water-2, 2, 2 M Castagnola , DV Rossetti, F Misiti , L Cassiano - of Chromatography A, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967397009205 Discovery of D-amino-acid-containing ligands with selectide technology KS Lam , M Lebl, V Krchnak, S Wade, F Abdul-Latif - Gene, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/037811199390245X A one-bead one-peptide combinatorial library method for B-cell epitope mapping KS Lam , D Lake , SE Salmon, J Smith , ML Chen - Methods, 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046202396900560 Proteolytic conversion of [Met] enkephalin-Arg6-Gly7-Leu8 by brain synaptic membranes. Characterization of formed peptides and mechanism of proteolysis. JA Norman, JY Chang - Journal of Biological Chemistry, 1985 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818894108 A Facile synthesis of NODASA-functionalized peptide J Dutta, PK Chinthakindi , PI Arvidsson , BG de la Torre - Synlett, 2016 - thieme-connect.comhttps://www.thieme-connect.com/products/ejournals/html/10.1055/s-0035-1561970 CH3-C HH OH - Modern Methods in Protein-and Nucleic Acid Research - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/9783110853537/pdf?licenseType=restricted#page=197 Release of the heptapeptide Met-enkephalin-Arg6-Phe7 and of the octapeptide Met-enkephalin-Arg6-Gly7-Leu8 from rat striatum in vitro and their rapid inactivation G Patey, A Cupo, M Chaminade, JL Morgat, J Rossier - Life Sciences, 1983 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0024320583904587 Synthesis and comparative properties of two amide-generating resin linkers for use in solid phase peptide synthesis FK Deng, K Mandal , S Luisier - Journal of Peptide , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.1279 Structural and pharmacological characteristics of chimeric peptides derived from peptide E and beta-endorphin reveal the crucial role of the C-terminal YGGFL and E Condamine , K Courchay, JC Do Rego, J Leprince - Peptides, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S019697811000032X Phylogenetic diversity and functional efficacy of the C-terminally expressed heptapeptide unit in the opioid precursor polypeptide proenkephalin A E Bojnik, E Boynik, M Corbani , F Babos, A Magyar - Neuroscience, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0306452211000315 Biochemical and pharmacological characterizations of the novel endogenous opioid peptide motifs and synthetic nociceptin hexapeptide sequences E Bojnik - 2009 - search.proquest.comhttps://search.proquest.com/openview/1961720f2757ed8bebcc207bef432a1b/1?pq-origsite=gscholar&cbl=2026366&diss=y Rearrangement Pathways of the a4 Ion of Protonated YGGFL Characterized by IR Spectroscopy and Modeling B Paizs , BJ Bythell , P Maaca®tre - Journal of the American Society for , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-011-0322-6 Identification of avidin and streptavidin binding motifs among peptides selected from a synthetic peptide library consisting solely of D-amino acids B Gissel, MR Jensen, K Gregorius - Journal of Peptide , 1995 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.310010402 The endogenous tripeptide Tyr-Gly-Gly as an extracellular metabolite of enkephalins in rat brain: origin and metabolism B Giros , C Llorens-Cortes , C Gros - Progress in Opioid , 1976 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=HZJx5Yza02IC&oi=fnd&pg=PA271&dq=(%22Fluor-Tyr-Gly-Gly-Phe-OH%22+OR+%22Fluor-YGGF-OH%22+OR+%22YGGF%22)+AND+peptide&ots=0Nw1rwps2l&sig=JEo-xqse_ckt7amCagivhb6fsrQ The endogenous tripeptide Tyr-Gly-Gly as a possible metabolite of opioid peptides in rat brain: identification, regional distribution, effects of lesions and formation in B Giros , C Llorens-Cortes , C Gros, JC Schwartz - Peptides, 1986 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0196978186900434 Biochemical and pharmacological characterization of three opioid-nociceptin hybrid peptide ligands reveals substantially differing modes of their actions AI Erdei , A Borbely , A Magyar , N Taricska, A Perczel - Peptides, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978117303182 NPYF a, A Chimeric Peptide of Met-Enkephalin, and NPFF Induces Tolerance-Free Analgesia A Mudgal, K Kumar, C Mollereau - Chemical Biology & , 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/cbdd.12721 Photodissociation spectroscopy of protonated leucine enkephalin A Herburger, C van der Linde, MK Beyer - Chemistry Chemical Physics, 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2016/cp/c6cp08436b

Peptide Biot-KKLNRTLSFAEPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Biot-KKLNRTLSFAEPG-NH2 include the following: Structural and thermodynamic analyses of interactions between death-associated protein kinase 1 and anthraquinones T Yokoyama, P Wijaya, Y Kosaka - Section D: Structural , 2020 - scripts.iucr.orghttps://scripts.iucr.org/cgi-bin/paper?lp5046 A fluorescence lifetime-based assay for serine and threonine kinases that is suitable for high-throughput screening MJ Paterson, CJ Dunsmore, R Hurteaux - Analytical , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269710001648 Vasoactivity of AG014699, a Clinically Active Small Molecule Inhibitor of Poly(ADP-ribose) Polymerase: a Contributory Factor to Chemopotentiation In vivo? M Ali , BA Telfer, C McCrudden , M O'Rourke - Clinical cancer , 2009 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/15/19/6106/74423 Crystal structure of Maternal Embryonic Leucine Zipper Kinase (MELK) in complex with dorsomorphin (Compound C) KP Rembacz, KM Zrubek, P Golik, K Michalik - Archives of biochemistry , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003986118310403 NDR KINASES ARE ESSENTIAL REGULATORS OF CYTOKINESIS IN BLOODSTREAM STAGE TRYPANOSOMA BRUCEI J Ma, C Benz, R Grimaldi, C Stockdale, P Wyatt - 2010 - academia.eduhttps://www.academia.edu/download/43800323/jbc.M109.074591.full.pdf Phosphorylation of microtubule-associated protein tau by AMPK-related kinases H Yoshida, M Goedert - Journal of neurochemistry, 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1471-4159.2011.07523.x Wnt Inhibitors D Gilota, F Giudicellia, D Lagadic-Gossmanna - wntinhibitors.comhttps://wntinhibitors.com/akti-12/ Hedgehog signaling D Gilota, F Giudicellia, D Lagadic-Gossmanna - hedgehog-signaling.comhttps://hedgehog-signaling.com/index.php/akti-12/ Akti-1/2, an allosteric inhibitor of Akt 1 and 2, efficiently inhibits CaMKIalpha activity and aryl hydrocarbon receptor pathway D Gilot , F Giudicelli, D Lagadic-Gossmann - Chemico-biological , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009279710005442 Vasoactivity of rucaparib, a PARP-1 inhibitor, is a complex process that involves myosin light chain kinase, P2 receptors, and PARP itself CM McCrudden , MG O'Rourke, KE Cherry, HF Yuen - PloS one, 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0118187 The potent AMPK inhibitor BAY-3827 shows strong efficacy in androgen-dependent prostate cancer models C Lemos, VK Schulze, SJ Baumgart - Cellular Oncology, 2021 - Springerhttps://link.springer.com/article/10.1007/s13402-020-00584-8 BAY-3827 C Lemos, VK Schulze, SJ Baumgart, E Nevedomskaya - vx-809modulator.comhttps://vx-809modulator.com/krt17/bay-3827/ First-in-class DAPK1/CSF1R dual inhibitors: Discovery of 3, 5-dimethoxy-N-(4-(4-methoxyphenoxy)-2-((6-morpholinopyridin-3-yl) amino) pyrimidin-5-yl) benzamide as AK Farag , AHE Hassan , H Jeong, Y Kwon - European Journal of , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523418309267

Antagonist of adenosine receptor A3

Rabbit polyclonal IRS1 antibody

GOLPH3 antibody was raised in Rabbit using Human GOLPH3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of UNC5C antibody, catalog no. 70R-7135

Peptide H-YPHTHLVQQANPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YPHTHLVQQANPR-OH include the following: A targeted proteomic assay for the measurement of plasma proteoforms related to human aging phenotypes RD Semba, P Zhang , M Zhu, E Fabbri - , 2017 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201600232 Quantification of GDF11 and myostatin in human aging and cardiovascular disease MJ Schafer , EJ Atkinson , PM Vanderboom, B Kotajarvi - Cell metabolism, 2016 - cell.comhttps://www.cell.com/cell-metabolism/pdf/S1550-4131(16)30245-5.pdf

Fibroblast Growth Factor protein containing 155 amino acids.

H-TLSDYNIQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLSDYNIQK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLSDYNIQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLSDYNIQK-OH at the technical inquiry form on this page

MCP2 antibody was raised in rabbit using highly pure recombinant murine MCP-2 (Mouse MCP-2) as the immunogen.

H-TAICEEMEKEGKITK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TAICEEMEKEGKITK-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TAICEEMEKEGKITK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TAICEEMEKEGKITK-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of PPIH antibody, catalog no. 70R-3821

Methylene Blue trihydrate finds many uses in biology and chemistry. It acts as a GCS inhibitor, biological stain and redox indicator. It inhibits tau filament formation. Further, it is reported to bind to the M2 subtype of muscarinic receptors in rat cardiac myocytes and thus exhibit antimuscarinic effects on IK, ACh and ICa. It also inhibits endothelium-dependent relaxation of isolated blood vessels. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

1-175 amino acids: MSSQIRQNYS TDVEAAVNSL VNLYLQASYT YLSLGFYFDR DDVALEGVSH FFRELAEEKR EGYERLLKMQ NQRGGRALFQ DIKKPAEDEW GKTPDAMKAA MALEKKLNQA LLDLHALGSA RTDPHLCDFL ETHFLDEEVK LIKKMGDHLT NLHRLGGPEA GLGEYLFERL TLKHD

Peptide H-FLEQELETITIPDVYGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLEQELETITIPDVYGAK^-OH include the following: The regulation of glucose and lipid homeostasis via PLTP as a mediator of BAT-liver communication CH Sponton, T Hosono, J Taura, MP Jedrychowski - EMBO , 2020 - embopress.orghttps://www.embopress.org/doi/abs/10.15252/embr.201949828

GLRX2 antibody was raised in Rabbit using Human GLRX2 as the immunogen

Purified Polyclonal CD42b antibody

Human sequence expressed in NS0 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

H-GWRPRRTILFASWDA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GWRPRRTILFASWDA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GWRPRRTILFASWDA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GWRPRRTILFASWDA-OH at the technical inquiry form on this page

Rabbit polyclonal TRAF1 antibody

Rabbit polyclonal ARFGAP1 antibody

H-APPLPVPGVLLKEFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-APPLPVPGVLLKEFT-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-APPLPVPGVLLKEFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-APPLPVPGVLLKEFT-OH at the technical inquiry form on this page

ASGR1 antibody was raised using the N terminal of ASGR1 corresponding to a region with amino acids RKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGS

Rabbit polyclonal CCL5 antibody (biotin)

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

AP3S2 antibody was raised in Rabbit using Human AP3S2 as the immunogen

LHX5 antibody was raised in Rabbit using Human LHX5 as the immunogen

Rabbit polyclonal RRAS2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of IL1F5 antibody, catalog no. 70R-9339

DUSP9 antibody was raised in Rabbit using Human DUSP9 as the immunogen

Vildagliptin is an antihyperglycemic agent that is used for the management of type 2 diabetes mellitus. This drug is a dipeptidyl peptidase 4 inhibitor and prevents the degradation of glucagon-like peptide 1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP). This leads to improved glycemic control. Vildagliptin is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Parpargyl-PEG4-alcohol

A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD1B antibody, catalog no. 20R-1218

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

DDX17 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 17 (Ddx17)

The TGF beta 1 antibody is a monoclonal antibody that specifically targets the growth factor TGF-beta 1. This antibody is reactive and can be used in various applications within the Life Sciences field. It has been shown to be effective in neutralizing the activity of TGF-beta 1, which plays a crucial role in cell proliferation, differentiation, and immune response regulation. The TGF beta 1 antibody is polymorphic, meaning it can recognize different forms of the target protein due to its specificity for specific epitopes. It has been successfully used in experiments involving imatinib-treated human serum samples, where it demonstrated its ability to detect activated TGF-beta 1. This antibody can be utilized in techniques such as immunoblotting and electrophoresis to study the expression and function of TGF-beta 1 in various biological systems.

VUF 10460 is a novel, potent and selective h3 receptor antagonist. It inhibits the proliferation of stomach cancer cells by blocking the binding of histamine to its receptors. VUF 10460 also blocks other histamine receptor subtypes, such as H1 and H2. These results indicate that VUF 10460 may have therapeutic potential for treating a number of autoimmune diseases, such as inflammatory bowel disease and rheumatoid arthritis.

Rabbit polyclonal TAF6L antibody

Mouse monoclonal Complement C1s antibody

CK2b

Mouse monoclonal SEC14L2 antibody

Peptide H-LFCASDAKAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LFCASDAKAY-OH include the following: Three regions of HIV-1 gp160 contain clusters of immunodominant CTL epitopes P Shankar, JA Fabry, DM Fong, J Lieberman - Immunology letters, 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0165247896025746 Supplemental Table 1. List of HIV class I peptides. M End - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/ed0f/0f087694817c860c5aad97fab618403c2847.pdf Ex Vivo Expansion of HIV Type 1-Specific Cytolytic T Cells from HIV Type 1-Seropositive Subjects J LIEBERMAN , JA FABRY, P SHANKAR - AIDS research and , 1995 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.1995.11.257

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX24 antibody, catalog no. 70R-4693

SeramunBlock NP

SSX7 antibody was raised in rabbit using the middle region of SSX7 as the immunogen

β-D-Galactose pentaacetate

ANA/SLE Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA/SLE Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Mouse monoclonal CD1c antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of FMO5 antibody, catalog no. 70R-6639

Purified recombinant KLK1 protein (His tag)

Please enquire for more information about CGP13156 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Goat anti-mouse IgM (Alk Phos) was raised in goat using murine IgM mu chain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACE2 antibody, catalog no. 70R-7469

Affinity purified Rabbit polyclonal NDUFS4 antibody

5-(Biotinamido)pentylamine

Peptide Ac-SQLRANISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-SQLRANISH-pNA include the following: Immunization with C5a peptidase from either group A or B streptococci enhances clearance of group A streptococci from intranasally infected mice PP Cleary, YV Matsuka, T Huynh, H Lam, SB Olmsted - Vaccine, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X04003755 Processing, stability, and kinetic parameters of C5a peptidase from Streptococcus pyogenes ET Anderson, MG Wetherell, LA Winter - European journal of , 2002 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1046/j.1432-1033.2002.03183.x

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of FANCE antibody, catalog no. 70R-2296