
Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules
- By Biological Target
- By Pharmacological Effects
- Cryopreservatives
- Desinfectants and Related Compounds
- Hormones
- Plant Biology
- Secondary Metabolites
Products of "Biochemicals and Reagents"
Sort by
Ac-CLSRFITANQYEMV-OH
Ac-CLSRFITANQYEMV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CLSRFITANQYEMV-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CLSRFITANQYEMV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CLSRFITANQYEMV-OH at the technical inquiry form on this pagePurity:Min. 95%MFAP4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFAP4 antibody, catalog no. 70R-6069Purity:Min. 95%Phenol Red, ACS
CAS:Phenol red is used as non absorbed marker in the gravimetric method. It is a pH indicator used in cell biology laboratories and in home swimming pool test kits. It is used to check the kidney function based on the excreted phenol red by colorimetric method. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.Formula:C19H14O5SMolecular weight:354.38Epigen protein
Region of Epigen protein corresponding to amino acids AVTVTPPITA QQADNIEGPI ALKFSHLCLE DHNSYCINGA CAFHHELEKA ICRCFTGYTG ERCEHLTLTS YA.Ac-CDLAPSKGTVN-NH2
Ac-CDLAPSKGTVN-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CDLAPSKGTVN-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CDLAPSKGTVN-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CDLAPSKGTVN-NH2 at the technical inquiry form on this pagePurity:Min. 95%Benzyl 2-O-tosyl-?-D-arabinopyranoside
CAS:Benzyl 2-O-tosyl-?-D-arabinopyranosideMolecular weight:394.44g/molGoat anti Chicken IgY (H + L) (biotin)
Goat anti Chicken IgY secondary antibody (Biotin)Purity:Min. 95%FBXL7 antibody
FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDH-IFWQNG-OH
Peptide H-IFWQNG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IFWQNG-OH include the following: Vascular Endothelial Growth Factor-Induced Osteopontin Expression Mediates Vascular Inflammation and Neointima Formation via Flt-1 in Adventitial Fibroblasts XD Li, J Chen, CC Ruan , DL Zhu - , thrombosis, and vascular , 2012 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/ATVBAHA.112.255216 Role of placenta growth factor and its receptor flt-1 in rheumatoid inflammation: a link between angiogenesis and inflammation SA Yoo , HJ Yoon, HS Kim , CB Chae - : Official Journal of , 2009 - Wiley Online Libraryhttps://acrjournals.onlinelibrary.wiley.com/doi/abs/10.1002/art.24289 Receptor-Mediated Endocytosis of VEGF-A in Rat Liver Sinusoidal Endothelial Cells SA Mousavi, F Skjeldal, MS Fonhus - BioMed research , 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2019/5496197 Research Article Receptor-Mediated Endocytosis of VEGF-A in Rat Liver Sinusoidal Endothelial Cells SA Mousavi, F Skjeldal, MS Fonhus, LH Haugen - 2019 - academia.eduhttps://www.academia.edu/download/69691263/5496197.pdf Anti-Flt1 peptide, a vascular endothelial growth factor receptor 1-specific hexapeptide, inhibits tumor growth and metastasis DG Bae, TD Kim, G Li, WH Yoon, CB Chae - Clinical cancer research, 2005 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/11/7/2651/188204 Biodegradable nanoparticles exposing a short anti-FLT1 peptide as antiangiogenic platform to complement docetaxel anticancer activity C Conte, F Moret , D Esposito, G Dal Poggetto - Materials Science and , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0928493119306332MBP (1-11), mouse
Custom research peptide; min purity 95%.Formula:C53H95N21O18Purity:Min. 95%Molecular weight:1,314.48 g/molPhenyl phosphate disodium salt dihydrate
CAS:Formula:C6H5PO4Na2·2H2OPurity:≥ 97.0%Color and Shape:White to off-white crystalline powderMolecular weight:218.06HSPBAP1 antibody
HSPBAP1 antibody was raised in rabbit using the N terminal of HSPBAP1 as the immunogenPurity:Min. 95%FNDC3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FNDC3B antibody, catalog no. 70R-1835Purity:Min. 95%