Biochemicals and Reagents

Tyroserleutide hydrochloride is an ion channel activator. It can be used as a research tool to study the function of ion channels and their ligands in cell biology and pharmacology. Tyroserleutide hydrochloride binds to the extracellular domain of the human erythrocyte receptor and activates it by changing its conformation. This agent also can inhibit protein-protein interactions, such as those between the receptor and its ligand.

Mouse monoclonal C1S antibody

ATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ37300 antibody, catalog no. 70R-5590

Sepantronium Bromide

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Please enquire for more information about Desbenzoyl docetaxel including the price, delivery time and more detailed product information at the technical inquiry form on this page

RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE

Please enquire for more information about Fenitrooxon-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal Cyclin B1 antibody

H-FAASAVGSRER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FAASAVGSRER-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FAASAVGSRER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FAASAVGSRER-OH at the technical inquiry form on this page

2,5-Bis(benzyloxy)-3-hydroxy-N,N'-bis[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]hexanediamide is a peptide that has been found to be an activator of ion channels. It has been shown to inhibit the activity of potassium and calcium channels in cell membranes and has also been shown to activate voltage gated sodium channels. 2,5-Bis(benzyloxy)-3-hydroxy-N,N'-bis[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-[yl]hexanediamide is a high purity reagent for use in research. CAS No: 214139

BCL2A1 antibody was raised in rabbit using the C terminal of BCL2A1 as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of MRTO4 antibody, catalog no. 70R-1198

ARP 101 is an advanced molecular compound designed for gene regulation research, which is synthesized from a highly refined organic substrate. Its mode of action involves binding to specific gene sequences, acting as a transcriptional modulator to either enhance or inhibit the expression of target genes. This is achieved through its precise interaction with transcriptional machinery and epigenetic factors, providing scientists with a powerful tool for elucidating mechanisms of gene expression and regulation. The applications of ARP 101 are vast, spanning from basic research in gene function to applied studies in genetic engineering and therapeutics. It is particularly valuable in studies aiming to understand complex genetic disorders, enabling the modification of gene expression in laboratory settings. Additionally, it has potential uses in synthetic biology, where custom gene networks are engineered for specific responses. Through its specificity and efficacy, ARP 101 serves as a critical component in both fundamental and translational biomedical research.

Rabbit polyclonal STAT5A antibody

Mouse monoclonal PDE6G antibody

Purified Rabbit polyclonal GNA14 antibody