Biochemicals and Reagents

Peptide H-FTLSVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FTLSVDR^-OH include the following: Development and validation of an LC-MS/MS method for simultaneous quantification of co-administered trastuzumab and pertuzumab S Schokker , F Fusetti, F Bonardi, RJ Molenaar - MAbs, 2020 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2020.1795492 Analytical and pharmacological consequences of the in vivo deamidation of trastuzumab and pertuzumab P Bults , A van der Voort, C Meijer, GS Sonke - Analytical and , 2022 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03756-z Enrichment and Liquid Chromatography-Mass Spectrometry Analysis of Trastuzumab and Pertuzumab Using Affimer Reagents O Olaleye, B Spanov, R Ford, N Govorukhina - Analytical , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.1c02807 Simultaneous quantification of co-administered trastuzumab and pertuzumab in serum based on nano-surface and molecular-orientation limited (nSMOL) proteolysis L Liu, B Sun, J Cai, J Wang, W Liu, H Hu, S Chen - RSC advances, 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2024/ra/d4ra03060e Method development and validation of LC-MS/MS-based assay for the simultaneous quantitation of trastuzumab and pertuzumab in cynomolgus monkey serum and L Gui, L Li, L Dong, S Xiang, J Zhai - Biomedical , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/bmc.4903 Wolfgang Paul Lecture K Prather - dgms2024.dehttps://dgms2024.de/fileadmin/media/dgms/2024/docs/Abstractbooklet_DGMS_2024_final_1103.pdf Session 1: Proteomics Oral Presentation J Poehls, C Landerer, D Richter, A Shevchenko - dgms2024.dehttps://dgms2024.de/fileadmin/media/dgms/2024/docs/Abstracts_dgms2024_07032024.pdf Simultaneous quantification of trastuzumab and pertuzumab in human serum using accurate mass spectrometry EN Simon Roberts - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/biopharma/RUO-MKT-02-15248-A_Quant_of_mAb_therapeutics_in_combination_therapy_using_the_ZenoTOF_7600_system_RB_Final.pdf Mass Spectrometric ITEM-ONE and ITEM-TWO Analyses Confirm and Refine an Assembled Epitope of an Anti-Pertuzumab Affimer C Röwer, OO Olaleye, R Bischoff , MO Glocker - Biomolecules, 2023 - mdpi.comhttps://www.mdpi.com/2218-273X/14/1/24 Pertuzumab charge variant analysis and complementarity-determining region stability assessment to deamidation B Spanov, O Olaleye, T Mesurado - Analytical , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.2c03275

Rimantadine-d4 hydrochloride is an inhibitor that binds to the signal peptide of the influenza virus. This prevents the virus from entering and infecting cells, which prevents replication and thus limits the spread of infection. Rimantadine-d4 hydrochloride has been shown to inhibit the replication of influenza A and B viruses in a number of treatment trials. It also inhibits viral reproduction by preventing the binding of influenza virus to its receptor on cells, which is essential for infection. The antiviral properties are due to its ability to bind to viral proteins and block their action, inhibiting viral production.

Kanamycin (50mg/ml)

A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS1 antibody, catalog no. 70R-1625

A synthetic peptide for use as a blocking control in assays to test for specificity of ZG16 antibody, catalog no. 70R-5441

Please enquire for more information about Vindoline including the price, delivery time and more detailed product information at the technical inquiry form on this page

MIP1 beta antibody (biotin) was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.

DMTF1 antibody was raised in mouse using recombinant Cyclin D Binding Myb-Like Transcription Factor 1

2-(2-(3-Phenylureido)thiazol-4-yl)-N-(4-(trifluoromethoxy)phenyl)acetamide is a potent inhibitor of angiotensin II. It has been shown to inhibit the binding of the peptide angiotensin II to its receptor, and thus prevents the activation of a number of biological responses including vasoconstriction, release of renin from the kidneys, and increased blood pressure. This drug is structurally similar to captopril, but with a different functional group on the phenyl ring. 2-(2-(3-Phenylureido)thiazol-4-yl)-N-(4-(trifluoromethoxy)phenyl)acetamide has also been shown to act as an inhibitor of ion channels that are involved in pain perception, such as voltage gated calcium channels.

Rabbit polyclonal TLP11 antibody

Boc-Val-Pro-Arg-AMC is a peptide that activates ion channels. It is an agonist of the nicotinic acetylcholine receptor (nAChR) and can be used in research to investigate the pharmacology of nAChRs. Boc-Val-Pro-Arg-AMC can also be used as a high purity ligand for antibody production, which has applications in cell biology and other life science research.

ATG4C antibody was raised in rabbit using the middle region of ATG4C as the immunogen

Peptide H-YRHYCYSLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YRHYCYSLY-OH include the following: Identification of human papillomavirus-16 E6 variation in cervical cancer and their impact on T and B cell epitopes A Kumar , S Hussain , IS Yadav , L Gissmann - Journal of virological , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166093415000841

Peptide H-EALYLVCGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EALYLVCGE-OH include the following: C-terminal modification of the insulin B: 11-23 peptide creates superagonists in mouse and human type 1 diabetes Y Wang , T Sosinowski, A Novikov - Proceedings of the , 2018 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1716527115 Antigen recognition in autoimmune diabetes: a novel pathway underlying disease initiation X Wan , ER Unanue - Precision Clinical Medicine, 2018 - academic.oup.comhttps://academic.oup.com/pcm/article-abstract/1/3/102/5201040 The insulin-specific T cells of nonobese diabetic mice recognize a weak MHC-binding segment in more than one form MG Levisetti , A Suri, SJ Petzold - The Journal of , 2007 - journals.aai.orghttps://journals.aai.org/jimmunol/article/178/10/6051/74082 The Insulin-Specific T Cells of Nonobese DMR a Weak - J Immunol, 2007 - academia.eduhttps://www.academia.edu/download/45035175/6051.full.pdf HLA-DQbeta57, anti-insulin T cells and insulin mimicry in autoimmune diabetes AR Garcaca­a, A Paterou, RDP Doherty, LG Landry, M Lee - medRxiv, 2022 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2022.05.11.22274678.abstract

Please enquire for more information about Fructose-1,6-Bisphosphatase 1, human, recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Methyl D-galactofuranoside

Peptide H-GILGFVFTL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GILGFVFTL^-OH include the following: Procedure for preparing peptide-major histocompatibility complex tetramers for direct quantification of antigen-specific cytotoxic T lymphocytes XH He, LH Xu, Y Liu - World Journal of Gastroenterology: WJG, 2005 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4615439/ Combinatorial HLA-peptide bead libraries for high throughput identification of CD8+ T cell specificity X Pan, LC Huang, T Dong , Y Peng, V Cerundolo - Journal of , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022175913003608 Sequence dependent conformational motion of a peptide in the HLA-A2 binding groove WS Meng , TK Gallaher - Protein and Peptide , 1996 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=4hzqbXzny7cC&oi=fnd&pg=PA51&dq=(%22H-GILGFVFTL%5E-OH%22+OR+%22GILGFVFTL%22+OR+%22GILGFVFTL%5E%22+OR+%22H-GILGFVFTL-OH%22)+AND+peptide&ots=apCmiTpzVI&sig=8sTkOvSFOHdm8h1mbPxa-YE8LFI Rational design of peptide-based tumor vaccines WS Meng , LH Butterfield - Pharmaceutical research, 2002 - Springerhttps://link.springer.com/article/10.1023/A:1016497818471 Exploiting the Peptide-MHC Water Interface in the Computer-Aided Design of Non-Natural Peptides that Bind to the Class I MHC Molecule HLA-A2 WS Meng , HH Bui, IS Haworth - Molecular Simulation, 2000 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/08927020008022372 A model of water structure inside the HLA-A2 peptide binding groove. WS Meng , H von Grafenstein - International , 1997 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/9/9/1339/761015 The mechanistic basis of peptide-MHC binding and design of MHC-directed therapeutics WS Meng - 1998 - search.proquest.comhttps://search.proquest.com/openview/4e50691d9270fd629aa3e6ea0137cec2/1?pq-origsite=gscholar&cbl=18750&diss=y Development of Pro-Peptide Immunotherapy for Breast Cancer W Wei-Zan, WAYNE STATE UNIV DETROIT MI - 2000., 2000 - apps.dtic.milhttps://apps.dtic.mil/sti/citations/tr/ADA385378 CHARACTERISATION OF MHC-PEPTIDE BINDING SPECIFICITIES BY STRUCTURAL STUDIES TOH XINYU - 2012 - core.ac.ukhttps://core.ac.uk/download/pdf/48655789.pdf Functional characterization of CTL against gp100 altered peptide ligands SO Dionne, MH Smith, FM Marincola - Cancer Immunology , 2003 - Springerhttps://link.springer.com/article/10.1007/s00262-002-0358-3 Towards chemically altered peptide ligands as T cell-targeted influenza vaccines SKR Huber, JJ Luimstra - for peptide , 2015 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A2919352/download#page=106 Chemical modification of influenza CD8+ T-cell epitopes enhances their immunogenicity regardless of immunodominance SK Rosendahl Huber, JJ Luimstra, J van Beek - PloS one, 2016 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0156462 Immune responses against conserved influenza epitopes: lessons for peptide S Rosendahl Huber - Scand J Immunol, 1997 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A2919359/download Synthesis and biological activity of the prodrug of class I major histocompatibility peptide GILGFVFTL activated by beta-glucuronidase S Rawale, LM Hrihorczuk, Wei - Journal of medicinal , 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm010352w Epitope Prediction Algorithms for Class I MHC Molecules RG Urban, RM Chicz, KC Parker - MHC Molecules: Expression, Assembly , 1996 - Springerhttps://link.springer.com/chapter/10.1007/978-1-4684-6462-7_10 Altered peptide ligands revisited: Vaccine design through chemically modified HLA-A2-restricted T cell epitopes R Hoppes, R Oostvogels , JJ Luimstra - The Journal of , 2014 - journals.aai.orghttps://journals.aai.org/jimmunol/article/193/10/4803/97379 Whole inactvated influenza virus as an adjuvant for influenza peptide antigens PC Soema, SKR Huber, GJ Willems, JP Amorij - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A2895100/download Endogenous peptides bound to HLA-A3 possess a specific combination of anchor residues that permit identification of potential antigenic peptides. M DiBrino, KC Parker, J Shiloach - Proceedings of the , 1993 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.90.4.1508 Competition among peptides in melanoma vaccines for binding to MHC molecules LW Thompson, CF Garbee, S Hibbitts - Journal of , 2004 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2004/11000/competition_among_peptides_in_melanoma_vaccines.2.aspx Real time detection of peptide-MHC dissociation reveals that improvement of primary MHC-binding residues can have a minimal, or no, effect on stability KM Miles, JJ Miles , F Madura, AK Sewell , DK Cole - Molecular immunology, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589010006073 Scheme for ranking potential HLA-A2 binding peptides based on independent binding of individual peptide side-chains. KC Parker, MA Bednarek, JE Coligan - Journal of immunology , 1994 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/152/1/163/25918 Analysis of a naturally occurring HLA class I-restricted viral epitope. K Falk, O Rötzschke , S Stevanović, V Gnau - , 1994 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC1414868/ Immunodominant influenza epitope GILGFVFTL engage common and divergent TCRs when presented as a 9-mer or a 15-mer peptide K Bhojak, V Kode, CM Miriam, K Lee, A Ramesh - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.07.11.499638.abstract Peptide mimic for influenza vaccination using nonnatural combinatorial chemistry JJ Miles , MP Tan, G Dolton - The Journal of , 2018 - Am Soc Clin Investighttps://www.jci.org/articles/view/91512 Identification of CD19 and CD20 peptides for induction of antigen-specific CTLs against B-cell malignancies J Bae, JA Martinson, HG Klingemann - Clinical cancer research, 2005 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/11/4/1629/188888 CTL recognition of a novel HLA-A* 0201-binding peptide derived from glioblastoma multiforme tumor cells CE Myers, P Hanavan, K Antwi, D Mahadevan - Cancer Immunology , 2011 - Springerhttps://link.springer.com/article/10.1007/s00262-011-1032-4 Structural and functional characterization of peptide-beta2m fused HLA-A2/MART127-35 complexes C Shen, CC Chang, J Zhang, W Guo, L Xia - Biochemical and , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X06001999 Peptide-pulsed dendritic cells induce tumoricidal cytotoxic T lymphocytes from healthy donors against stably HLA-A* 0201-binding peptides from the Melan-A/MART A van Elsas , SH van der Burg - European journal of , 1996 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830260803 Induction and characterization of cytotoxic T-lymphocytes recognizing a mutated p21ras peptide presented by HLA-A* 0201 A Van Elsas , HW Nijman - journal of cancer, 1995 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.2910610319 Immunological interactions of virus peptides at the antigen presenting MHC I proteins A Rashidian - Bioinformatics, 2018 - utupub.fihttps://www.utupub.fi/bitstream/handle/10024/146525/Rashidian_Azam_Thesis.pdf?sequence=1 Use of Immobilized HLA-A2:Ig Dimeric Proteins to Determine the Level of Epitope-Specific, HLA-Restricted CD8+ T-Cell Response A Horowitz , X Li, MA Poles - Scandinavian journal of , 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-3083.2009.02317.x Identification of B cell epitopes reactive to human papillomavirus type-16L1-derived peptides A Fukui, S Matsueda , K Kawano, N Tsuda, N Komatsu - Virology journal, 2012 - Springerhttps://link.springer.com/article/10.1186/1743-422X-9-199

RNF186 antibody was raised using the N terminal of RNF186 corresponding to a region with amino acids MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP