Biochemicals and Reagents

This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.

Peptide H-VYNVTYTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYNVTYTVK^-OH include the following: Accurate quantitation of dystrophin protein in human skeletal muscle using mass spectrometry KJ Brown, R Marathi, AA Fiorillo - Journal of bioanalysis , 2012 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3642779/ Absolute quantification of dystrophin protein in human muscle biopsies using parallel reaction monitoring (PRM) EH Canessa , MV Goswami , TD Alayi - Journal of mass , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.4437

MLT-747 is a high-performance polymer composite, which is a synthetic material derived from advanced polymerization techniques involving specific monomers and additives. Its formulation is designed to provide exceptional mechanical properties and thermal stability through the integration of reinforcing agents and proprietary chemical modifications. The mode of action of MLT-747 involves the formation of an interconnected polymer matrix that enhances strength, durability, and resistance to extreme environmental conditions. This matrix structure utilizes cross-linking and entanglement of polymer chains, resulting in a material that can withstand significant mechanical stress and thermal exposure. The applications of MLT-747 are broad and span across several industries. It is particularly well-suited for use in aerospace and automotive sectors, where high-performance materials are essential for reducing weight while maintaining structural integrity. Additionally, MLT-747 is employed in the electronics industry, where it acts as an insulating layer with excellent dielectric properties, ensuring both performance and safety in electronic devices. The material’s versatility and robust nature make it a valuable asset in advanced manufacturing and engineering fields, enabling innovations while meeting rigorous industry standards.

Rabbit polyclonal HBP1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC37A3 antibody, catalog no. 70R-7010

Peptide H-ILGGHLDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ILGGHLDAK-OH include the following: Protein signatures associated with tumor cell dissemination in head and neck cancer OB Bleijerveld, RH Brakenhoff, TBM Schaaij-Visser - Journal of , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S187439191100025X Amino acids and proteins N Taniguchi - Medical Biochemistry, Ed, 2010 - academia.eduhttps://www.academia.edu/download/43628938/Chapter_2002.pdf Effects of natalizumab treatment on the cerebrospinal fluid proteome of multiple sclerosis patients MP Stoop, V Singh , C Stingl, R Martin - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3012107 Comprehensive proteomic profiling of pressure ulcers in patients with spinal cord injury identifies a specific protein pattern of pathology M Baldan-Martin, T Martin-Rojas - Advances in Wound , 2020 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/wound.2019.0968 Subunit-specific mass spectrometry method identifies haptoglobin subunit alpha as a diagnostic marker in non-small cell lung cancer J Park, JS Yang, G Jung, HI Woo, HD Park, JW Kim - Journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391913005101

Vimentin antibody was raised in goat using imentin purified from cultured human foreskin fibroblasts as the immunogen.

CYP3A4 (36-55) Heavy is an isoform of the Cytochrome P450s and has the ability to metabolise a wide variety of compounds. The lysine residue at position 20 is isotopically labelled with carbon-13 (6) and nitrogen-15 (2).

Peptide H-CMLVELHTQSQDRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CMLVELHTQSQDRF-NH2 include the following: Identification of lysine isobutyrylation as a new histone modification mark Z Zhu, Z Han , L Halabelian , X Yang , J Ding - Nucleic Acids , 2021 - academic.oup.comhttps://academic.oup.com/nar/article-abstract/49/1/177/6031446 Effective quenchers are required to eliminate the interference of substrate: cofactor binding in the HAT scintillation proximity assay L Ngo, J Wu, C Yang, YG Zheng - Assay and drug development , 2015 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/adt.2015.636 Novel insights into p300 histone acetyltransferase activity: Inhibition and modulation EM Bowers - 2011 - search.proquest.comhttps://search.proquest.com/openview/7df01c45fcaf1646c6d963e5c65b556c/1?pq-origsite=gscholar&cbl=18750 Multiple roles for acetylation in the interaction of p300 HAT with ATF-2 B Karanam , L Wang, D Wang, X Liu , R Marmorstein - Biochemistry, 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi7000054 Kinetic and mass spectrometric analysis of p300 histone acetyltransferase domain autoacetylation B Karanam , L Jiang, L Wang, NL Kelleher - Journal of Biological , 2006 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)76866-3/abstract

Ac-SSPAVEQQLLVSGPGK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SSPAVEQQLLVSGPGK-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SSPAVEQQLLVSGPGK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SSPAVEQQLLVSGPGK-NH2 at the technical inquiry form on this page

FGL2 antibody was raised using the middle region of FGL2 corresponding to a region with amino acids WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL

Mouse monoclonal CD1b antibody

Rat monoclonal Dendritic Cell antibody (PE)

Mouse monoclonal AGPAT5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DPP6 antibody, catalog no. 70R-6835

Mouse monoclonal GIP antibody

Ethylene glycolbis(succinimidylsuccinate)

C1ORF25 antibody was raised in rabbit using the N terminal of C1ORF25 as the immunogen

Topoisomerase I inhibitor