Biochemicals and Reagents

Purified Polyclonal Factor VIII antibody

Lanopepden is an antibiotic drug with broad-spectrum antibacterial activity. It is a modified version of the natural product, lanosin A. Lanopepden has been shown to be active against Gram-positive and Gram-negative bacteria, including Enterobacteriaceae and Staphylococcus aureus strains that are resistant to other antibiotics. Lanopepden inhibits bacterial growth by binding to the 50S ribosomal subunit, which leads to inhibition of protein synthesis and cell death. Lanopepden has also been shown to have good skin penetration properties in mice models.

Mouse Anti Mullerian Hormone antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MTNR1A antibody, catalog no. 70R-10327

Purified recombinant OSM protein

Mouse monoclonal SERPINB6 antibody

Mouse monoclonal PPARA antibody

GFP antibody (HRP) was raised in Mouse using The immunogen is a GST- Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria. as the immunogen.

Amido Black 10B is used as a histological, protein, and nucleic acid dye used in electrophoresis. Naphthol Blue Black is an important and commonly used industrial dye. This dye is also used in rapid staining of protein bands on nitrocellulose membranes such as Western blots. Naphthol Blue Black can be utilized as a nucleic acid stain in SDS-Page gels. Additionally this compound has been untilized in cell proliferation assays and histochemical studies. It is also used in criminal investigations to detect blood present with latent fingerprints. They are also used in paints, inks, plastics and leather. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Mouse monoclonal DTNA antibody

CTNND1 antibody was raised in Rabbit using Human CTNND1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SRD5A2 antibody, catalog no. 70R-7329

Septin 6 antibody was raised using the middle region of 40427 corresponding to a region with amino acids CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Catalogue peptide; min. 95% purity

GST antibody was raised in Mouse using purified fusion protein with GST protein tag expressed in E. coli as the immunogen.

3-Deoxy-3-fluoro-D-allose