Biochemicals and Reagents

FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ

Recombinant Human Heat Shock Protein 27

DFS-70 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about DFS-70 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Peptide H-DSWMEEVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSWMEEVIK^-OH include the following: Identification and quantification of human relaxin proteins by immunoaffinity-mass spectrometry Y Rais, AP Drabovich - Journal of Proteome Research, 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.4c00027

Catalogue peptide; min. 95% purity

Rabbit polyclonal CDK5R2 antibody

Peptide H-GISSLGVGSCGSSCRKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GISSLGVGSCGSSCRKC-OH include the following: Transcription regulation and protein subcellular localization of the truncated basic hair keratin hhb1-ÎŽn in human breast cancer cells A Boulay, CH Regnier , P Anglard , I Stoll - Journal of Biological , 2001 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)78591-1/abstract

Rabbit polyclonal SLC27A5 antibody

Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Rabbit polyclonal CYP4Z1 antibody

CKBB antibody was raised in goat using purified human brain CKBB as the immunogen.

H-AEEPTAGGSLELPGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AEEPTAGGSLELPGR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AEEPTAGGSLELPGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AEEPTAGGSLELPGR-OH at the technical inquiry form on this page

Rabbit polyclonal HMGB1 antibody (biotin)

IWS1 antibody was raised in Rabbit using Human IWS1 as the immunogen

Conjugated Phencyclidine-HRP hapten

Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI

H-LSVMNVPDF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LSVMNVPDF-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LSVMNVPDF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LSVMNVPDF-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF768 antibody, catalog no. 70R-9586

6-Chloropurine 2'-deoxyriboside is used in the synthesis of 9-(2,3-dideoxy-2-fluoro-beta-D-threo-pentofuranosyl)adenine. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified recombinant BCAR1 protein (His tag)

The PTX3 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It has been shown to be highly effective in various applications, including chromatin immunoprecipitation assays and nuclear extracts. This antibody specifically targets PTX3, a protein that is activated in granulosa cells and plays a crucial role in the regulation of peptide hormones. The PTX3 antibody has also been used in cortical cultures and primary neuron cultures to study synaptic proteins and mitogen-activated protein signaling pathways. With its high specificity and reliability, this antibody is an essential tool for researchers looking to investigate the intricate mechanisms of cellular processes.

Peptide H-TISSEDEPFNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TISSEDEPFNLR-OH include the following: Detection of soybean allergens based on isotope dilution mass spectrometry: Development, validation, and applications in complex food matrices M Liu, H Luan, L Yin, X Hua, X Jia - Microchemical Journal, 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0026265X24009123

Purified recombinant VTCN1 protein (His tag)

MYL1 antibody was raised in Rabbit using Human MYL1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS8 antibody, catalog no. 70R-4537

Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CSEGEKARKNIVLARRRP-NH2 include the following: Regulation of PCDH15 function in mechanosensory hair cells by alternative splicing of the cytoplasmic domain SW Webb, N Grillet , LR Andrade , W Xiong - , 2011 - journals.biologists.comhttps://journals.biologists.com/dev/article-abstract/138/8/1607/45003

TRPC6 antibody was raised using the middle region of TRPC6 corresponding to a region with amino acids KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE

Mouse monoclonal SHPK antibody

H-AFLASPEYVNLPINGNGK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AFLASPEYVNLPINGNGK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AFLASPEYVNLPINGNGK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AFLASPEYVNLPINGNGK-OH at the technical inquiry form on this page

H-HTPPVTS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HTPPVTS-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HTPPVTS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HTPPVTS-OH at the technical inquiry form on this page

Firuglipel is a synthetic biocompound, which is derived from advanced organic synthesis processes and designed for biotechnological applications. It functions as an enzyme inhibitor, leveraging its unique ability to interact with specific metabolic pathways. This interaction involves competitive binding to active sites within target enzymes, effectively modulating biochemical reactions. The primary use of Firuglipel is in biochemical research, where it serves as a crucial tool in studying enzyme function and metabolic processes. Its ability to selectively inhibit enzymes makes it invaluable in pharmacological studies, particularly in dissecting complex signaling pathways. Additionally, Firuglipel has potential applications in drug development, offering insights into therapeutic targets for diseases associated with enzyme dysregulation. As researchers continue to explore the intricate relationships between enzymes and disease, Firuglipel provides an essential resource for elucidating these connections, thus contributing to advancements in both fundamental and applied sciences.

Purified Polyclonal Cytochrome P450 1A1/2 antibody

Rabbit Polyclonal GIRK1 antibody (Ser185)

Pan-Akt inhibitor

Ac-CRGDDTGVLLPTPGE-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CRGDDTGVLLPTPGE-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CRGDDTGVLLPTPGE-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CRGDDTGVLLPTPGE-NH2 at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of FCN1 antibody, catalog no. 70R-9277

Desfuroyl Ceftiofur

Peptide H-LLIIGASTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLIIGASTR-OH include the following: Whole-tissue Mapping of> 5000 proteins by Micro-scaffold Assisted Spatial Proteomics (MASP) M Ma, S Huo, M Zhang, S Qian, X Zhu, J Pu, S Rasam - 2022 - researchsquare.comhttps://www.researchsquare.com/article/rs-1786070/latest In-depth mapping of protein localizations in whole tissue by micro-scaffold assisted spatial proteomics (MASP) M Ma, S Huo , M Zhang, S Qian , X Zhu , J Pu - Nature , 2022 - nature.comhttps://www.nature.com/articles/s41467-022-35367-2

Rabbit Polyclonal ARHGEF2 antibody (Ser885)

A synthetic peptide for use as a blocking control in assays to test for specificity of SNAG1 antibody, catalog no. 70R-9638