Biochemicals and Reagents

Goat anti-human lambda chain (Fab'2) was raised in goat using human lambda light chain as the immunogen.

Mouse monoclonal MSI1 antibody

Mouse Albumin protein is a highly versatile protein that plays a crucial role in various biological processes. It is composed of disulfide bonds and glutamate residues, which contribute to its stability and function. This protein is widely used in research and diagnostics as it serves as an excellent target for monoclonal antibodies. The serum albumin binding property of Mouse Albumin protein allows for the development of specific antibodies that can be utilized in various applications, including immunohistochemistry, ELISA, and Western blotting. In addition to its binding capabilities, Mouse Albumin protein has been found to interact with phalloidin, a toxin that selectively binds to actin filaments. This interaction has been extensively studied to better understand the dynamics of actin cytoskeleton and cellular processes such as cell migration and muscle contraction. Furthermore, Mouse Albumin protein has been implicated in autoimmune diseases, as autoantibodies against this protein have been detected in certain patient populations. These autoantibodies have been

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F1 antibody, catalog no. 70R-7103

Rabbit polyclonal Basigin antibody (biotin)

H-CGGLGEFKDERNLEIFEPSI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGLGEFKDERNLEIFEPSI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGLGEFKDERNLEIFEPSI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGLGEFKDERNLEIFEPSI-OH at the technical inquiry form on this page

Peptide H-EQQCVIMAENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EQQCVIMAENR-OH include the following: Longitudinal serum proteome characterization of COVID-19 patients with different severities revealed potential therapeutic strategies S Wu, Y Xu, J Zhang, X Ran, X Jia, J Wang- Frontiers in ..., 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2022.893943/full

CD247 antibody was raised in Mouse using a purified recombinant fragment of human CD247 expressed in E. coli as the immunogen.

Mouse monoclonal XPNPEP3 antibody

Peptide H-WLQGSQELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WLQGSQELPR^-OH include the following: Mass Spectrometry for the Study of Autism and Neurodevelopmental Disorders KL Wormwood , AG Ngounou Wetie , JP Ryan - Advancements of Mass , 2019 - Springerhttps://link.springer.com/chapter/10.1007/978-3-030-15950-4_28 Quantification of peptides from immunoglobulin constant and variable regions by liquid chromatography-multiple reaction monitoring mass spectrometry for ER Remily-Wood, K Benson , RC Baz - Proteomics. Clinical , 2014 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4302417/ Quantification of peptides from immunoglobulin constant and variable regions by LC-MRM MS for assessment of multiple myeloma patients ER Remily-Wood, K Benson , RC Baz - Proteomics-Clinical , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201300077 Alteration of microbiota antibody-mediated immune selection contributes to dysbiosis in inflammatory bowel diseases E Michaud, L Waeckel, R Gayet - EMBO Molecular , 2022 - embopress.orghttps://www.embopress.org/doi/abs/10.15252/emmm.202115386 Mass spectrometry-based method targeting Ig variable regions for assessment of minimal residual disease in multiple myeloma CO Martins , S Huet, Y San S, MS Ritorto - The Journal of Molecular , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1525157820300921 Aberrant RL2 O-GlcNAc antibody reactivity against serum-IgA1 of patients with colorectal cancer C Verathamjamras, T Sriwitool, P Netsirisawan - Glycoconjugate , 2021 - Springerhttps://link.springer.com/article/10.1007/s10719-021-09978-8

H-LGGGGGGDFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LGGGGGGDFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LGGGGGGDFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LGGGGGGDFR-OH at the technical inquiry form on this page

Mouse monoclonal BECN1 antibody

Rat monoclonal CD45 antibody (FITC)

Purified Polyclonal COX5A antibody

Rat monoclonal TER119 antibody (biotin)

FG8119 is a peptide that can be used as a research tool to study the interactions between proteins and receptors. FG8119 is an activator of ion channels, which are protein pores that allow ions to pass through the cell membrane. FG8119 is also an inhibitor of protein interactions and has been shown to inhibit receptor-ligand binding in pharmacological studies.

Rabbit polyclonal PNMT antibody

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE

H-ILPSVPK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ILPSVPK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ILPSVPK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ILPSVPK-OH at the technical inquiry form on this page

Tachykinin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

BDC2.5 mimotope 1040-51 is a mimotope of BDC2.5 T cells which can recognise glutamic acid decarboxylase epitopes.

Please enquire for more information about H-Gly-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal PROM2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of IMPAD1 antibody, catalog no. 70R-6370

Peptide H-RGFFYTPKTRRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RGFFYTPKTRRE-OH include the following: Incorporation of Aliphatic Proline Residues into Recombinantly Produced Insulin SL Breunig , JC Quijano, C Donohue - ACS Chemical , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschembio.3c00561 Characterization of proinsulin T cell epitopes restricted by type 1 diabetes-associated HLA class II molecules EL Ihantola, H Ilmonen, A Kailaanmaki - The Journal of , 2020 - journals.aai.orghttps://journals.aai.org/jimmunol/article/204/9/2349/107608

H-KEYALFYRLDIVPLN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KEYALFYRLDIVPLN-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KEYALFYRLDIVPLN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KEYALFYRLDIVPLN-OH at the technical inquiry form on this page

NEIL3 antibody was raised in mouse using recombinant Human Nei Endonuclease Viii-Like 3 (E. Coli)

HNRNPK antibody was raised in Rabbit using Human HNRNPK as the immunogen

Peptide H-RRIRPRPPRLPRPRPRP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RRIRPRPPRLPRPRPRP-OH include the following: Translocating proline-rich peptides from the antimicrobial peptide bactenecin 7 K Sadler, KD Eom, JL Yang, Y Dimitrova , JP Tam - Biochemistry, 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi026661l Interaction of the fragments characteristic of bactenecin 7 with phospholipid bilayers and their antimicrobial activity A Tani, S Lee, O Oishi, H Aoyagi- The journal of ..., 1995 - academic.oup.comhttps://academic.oup.com/jb/article-abstract/117/3/560/785456

Rabbit polyclonal GPRIN3 antibody

Peptide H-SRTPSLPTPPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SRTPSLPTPPTR-OH include the following: Phosphorylation of recombinant tau by cAMP-dependent protein kinase. Identification of phosphorylation sites and effect on microtubule assembly. CW Scott, RC Spreen, JL Herman, FP Chow - Journal of Biological , 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818540552

Purified Rabbit polyclonal TLP13 antibody

Rabbit polyclonal Cyclin G antibody

Lamin A+C Monoclonal Antibody

Purified recombinant Human EEF1E1 protein

H-NVSTVQCTHGIKPVVSTQLL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NVSTVQCTHGIKPVVSTQLL-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NVSTVQCTHGIKPVVSTQLL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NVSTVQCTHGIKPVVSTQLL-OH at the technical inquiry form on this page

1-Deoxymannojirimycin hydrochloride

Peptide Ac-CSEDAIEEEGEDGVGSPRS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CSEDAIEEEGEDGVGSPRS-NH2 include the following: Dysregulation of axonal sodium channel isoforms after adult-onset chronic demyelination MN Rasband , T Kagawa, EW Park - Journal of , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jnr.10675 Paranodal transverse bands are required for maintenance but not initiation of Nav1. 6 sodium channel clustering in CNS optic nerve axons MN Rasband , CM Taylor, R Bansal - Glia, 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/glia.10284 Sodium channel Nav1.6 is localized at nodes of Ranvier, dendrites, and synapses JH Caldwell, KL Schaller, RS Lasher - Proceedings of the , 2000 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.090034797 Age-related molecular reorganization at the node of Ranvier JD Hinman , A Peters, H Cabral - Journal of , 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/cne.20886

Benzyl 2,3-O-isopropylidene-β-D-erythrofuranoside