Biochemicals and Reagents

2-Deoxy-2-fluoro-L-fucose

Peptide H-IYLPHSLPQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IYLPHSLPQQ-OH include the following: Glutamyl-tRNAGln amidotransferase is essential for mammalian mitochondrial translation in vivo L Echevarria, P Clemente - Biochemical , 2014 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/460/1/91/46514

A synthetic peptide for use as a blocking control in assays to test for specificity of LEP antibody, catalog no. 70R-6221

Rabbit polyclonal LGR6 antibody

Rabbit polyclonal ARPC2 antibody (FITC)

Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI

H-EATNICGFLEGRGQC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EATNICGFLEGRGQC-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EATNICGFLEGRGQC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EATNICGFLEGRGQC-OH at the technical inquiry form on this page

Rabbit polyclonal MUNC18a antibody

Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NVTGFFQSFK^-OH include the following: Evaluation of organic anion transporting polypeptide 1B1 and 1B3 humanized mice as a translational model to study the pharmacokinetics of statins L Salphati, X Chu, L Chen , B Prasad , S Dallas - Drug Metabolism and , 2014 - ASPEThttps://dmd.aspetjournals.org/content/42/8/1301.short Human hepatic transporter signature peptides for quantitative targeted absolute proteomics: selection, digestion efficiency, and peptide stability A Mori, T Masuda , S Ito, S Ohtsuki - Pharmaceutical Research, 2022 - Springerhttps://link.springer.com/article/10.1007/s11095-022-03387-8

Purified Rabbit polyclonal p70 S6 Kinase antibody (Ser371)

Rat monoclonal CD144 antibody (PE)

Please enquire for more information about Dynapyrazole A including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RRP1 antibody, catalog no. 70R-3164

It is an agrochemical, organic and pharmaceutical intermediates. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

This peptide is recognised and cleaved by the enzyme Sortase A (SrtA) from-Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine. Cleavage results in the formation of a thioacyl intermediate between the peptide and SrtA. This intermediate is then resolved by the N-terminus of an (oligo)glycine nucleophile, resulting in the creation of a new peptide bond that links the peptide and its biotin tag to the incoming nucleophile.- This method of protein labelling is known as sortagging.This peptide contains an N-terminal biotin tag for detection and purification.

SC57666 is an inhibitor of the transport of cholesterol into cells. It has been shown to be effective in treating hepatitis and polycystic ovarian syndrome. The mechanism of action of SC57666 is not known, but it may work by inhibiting the production of Cox-2 and decreasing the production of pro-inflammatory cytokines such as IL-1, IL-6 and TNF-α. SC57666 also inhibits hyperproliferative diseases such as cancer by preventing oxidative phosphorylation. SC57666 has also shown to have anti-inflammatory activity through its inhibitory effect on serotonin reuptake and cholinergic transmission.

A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD3 antibody, catalog no. 70R-8465

Rabbit polyclonal PAK1/PAK2/PAK3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2C1 antibody, catalog no. 70R-3471

Mouse monoclonal CD95 antibody (PE)

Catalogue peptide; min. 95% purity

Applications N-1-Naphthalenyl-2-[(3-thienylcarbonyl)amino]-4-thiazoleacetamide is derived from ethyl 2-amino-4-thiaxolacetate (E899330) and 1-naphthylamine (N378015). Ethyl 2-amino-4-thiaxolacetate is used in the synthesis of various pharmaceutical and biologically active compounds including inhibitors and antibiotics and 1-naphthylamine is a commonly used reagent that is used to produce various dyes. References Inamoto, Y., et al.: J. Antibiot., 41, 828 (1988),

UBE2L6 antibody was raised using the middle region of UBE2L6 corresponding to a region with amino acids QVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRP

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM63C antibody, catalog no. 70R-6894

Rabbit polyclonal c-Jun antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of WNT9B antibody, catalog no. 70R-7246

Rabbit polyclonal RRAGA antibody

Rabbit polyclonal LRRK1 antibody

The GMCSF antibody is a highly specialized protein used in the field of Life Sciences. It is commonly used in research and diagnostic applications. This antibody plays a crucial role in regulating the growth and development of various cells in the body, including white blood cells. The GMCSF antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their specific needs. It has been extensively studied and proven to be effective in targeting specific proteins such as epidermal growth factor, trastuzumab, fibronectin, β-catenin, collagen, anti-her2 antibody, vegf-c, hepatocyte growth factor, endothelial growth factor, and many others. By binding to these proteins, the GMCSF antibody can modulate their activity and influence various cellular processes. Its ability to target specific molecules makes it a valuable tool for understanding disease mechanisms and developing targeted therapies. In addition to its research applications, the GMCSF

Rabbit anti-goat IgG (FITC) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.

Purified Polyclonal TDG antibody

Semaglutide is a peptide that is used as a pharmacological agent for the treatment of type 2 diabetes, and other diseases and is also used for long-term weight management in obesity. It is an analogue of glucagon-like peptide-1 (GLP-1) and acts as a GLP-1 receptor agonist and inhibitor of the enzyme DPP-4, which is responsible for the degradation of GLP-1. As a result, semaglutide increases levels of GLP-1, which stimulates insulin release from pancreatic beta cells. Semaglutide has been shown to reduce body weight, blood pressure and HbA1c levels in patients with type 2 diabetes, through its action to increase insulin production and inhibit the production of glucagon. Semaglutide acetate is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.

Tb-ε Heavy.

Rabbit polyclonal VATPase G1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of HOXA11 antibody, catalog no. 70R-9590

1-tert-Butyl-3-[2-(3-methoxyphenoxy)-5-nitrophenyl]sulfonylurea is a highly specialized sulfonylurea herbicide. It is synthetically derived from intricate chemical processes involving phenoxy and nitrophenyl compounds. The mode of action involves the inhibition of the acetolactate synthase (ALS) enzyme in susceptible plants. This inhibition disrupts the biosynthesis of branched-chain amino acids, leading to the cessation of cell division and growth in the targeted weed species. The primary application of this compound is in the selective management of broadleaf weeds in cereal crops. By exploiting the differential enzyme sensitivities between crop plants and weeds, this sulfonylurea offers a powerful tool in agricultural weed control strategies. It provides effective pre- and post-emergent weed control, resulting in higher crop yields and healthier plant growth. However, its deployment requires careful management to mitigate resistance development and to minimize any non-target effects. This compound exemplifies the intricate balance of chemical innovation and agricultural necessity, contributing to sustainable farming practices.

Rat monoclonal 41BB Ligand antibody (PE)

Rat sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR

Fluorogenic probe used for the detection of reactive oxygen species

Rabbit polyclonal OSBPL11 antibody

ELISA Kit for detection of IL7 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of DNMT3B antibody, catalog no. 70R-2283

Purified recombinant SERPING1 protein (His tag)

SPIC antibody was raised in rabbit using the N terminal of SPIC as the immunogen

Mouse Anti Human FAS (CD95) Activating antibody

GCSF antibody was raised in Mouse using recombinant human G-CSF as the immunogen.

Rabbit polyclonal Stathmin 1 antibody (Ser15)