Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC34A3 antibody, catalog no. 70R-7873

Peptide H-RIFSTDTGPGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RIFSTDTGPGGC-OH include the following: Structural basis of substrate recognition and specificity in the N-end rule pathway E Matta-Camacho , G Kozlov, FF Li - Nature structural & , 2010 - nature.comhttps://www.nature.com/articles/nsmb.1894

CD32 antibody (PE) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.

Succinic acid

Peptide H-WMTNNPPIPVGEIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WMTNNPPIPVGEIYK-OH include the following: Identification of circulating antigen-specific CD4+ T lymphocytes with JM Newton, CR Mackay, DA Cooper, NK Saksena - academia.eduhttps://www.academia.edu/download/42745742/Identification_of_circulating_antigen-sp20160216-13262-wgqv7u.pdf Identification of circulating antigen-specific CD4+ T lymphocytes with a CCR5+, cytotoxic phenotype in an HIV-1 long-term nonprogressor and in CMV infection JJ Zaunders , WB Dyer , B Wang, ML Munier - Blood, 2004 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/103/6/2238/18356 Possible clearance of transfusion-acquired nef/LTR-deleted attenuated HIV-1 infection by an elite controller with CCR5 Δ32 heterozygous and HLA-B57 J Zaunders , WB Dyer , M Churchill , CML Munier - Journal of virus , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S205566402030056X

Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TTPPV^LDSDGSFFLYSR^-OH include the following: Absolute quantitation of immunoglobulin G and its glycoforms using multiple reaction monitoring Q Hong , CB Lebrilla , S Miyamoto - Analytical chemistry, 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac4009995 Method limitations in LC-MS/MS and immunonephelometric measurement of IgG subclasses G van der Gugten , A Mattman , G Ritchie - Clinical , 2021 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/67/2/440/6040699 Development of an LC-MS/MS method for absolute quantification of IgG4 by evaluating dependence on the digestion efficiency using a non-cleavable/dually D Sasaki, H Kashiwagura, Y Teruuchi - Biochemical and Biophysical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X23011737 Absolute and multiplex quantification of antibodies in serum using PSAQ™standards and LC-MS/MS D Lebert, G Picard, C Beau-Larvor, L Troncy - Bioanalysis, 2015 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.15.56

Please enquire for more information about anti-Human B2M Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

EIF2S3 antibody was raised in Rabbit using Human EIF2S3 as the immunogen

NCOR1 antibody was raised in Rabbit using Human NCOR1 as the immunogen

Treponema pallidum antibody was raised in goat using Treponema pallidum as the immunogen.

Peptide H-SITSAVLQSGFRKMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SITSAVLQSGFRKMA-OH include the following: Screening of drugs by FRET analysis identifies inhibitors of SARS-CoV 3CL protease YC Liu, V Huang, TC Chao , CD Hsiao, A Lin - Biochemical and , 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X0501051X Steady-State and Pre-Steady-State Kinetic Evaluation of Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) 3CLpro Cysteine Protease: Development of J Solowiej, JA Thomson, K Ryan, C Luo, M He - Biochemistry, 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi702107v

Rabbit polyclonal MRPL47 antibody

Rabbit polyclonal STAT1 antibody

Rabbit polyclonal Seed G9 antibody

YHO-13351 is a potent and selective activator of the TRPA1 ion channel. It has been shown to inhibit the activity of protein kinase C (PKC) and PKC-dependent phospholipase A2, which are enzymes that regulate inflammatory responses. YHO-13351 has also been shown to be an antagonist for the β2 adrenergic receptor. The high purity of this compound enables its use as a research tool in cell biology and pharmacology.

PLP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL

Purified Recombinant CD5l protein (His tagged)

Influenza A antibody was raised in mouse using Influenza A as the immunogen.

RAVER1 antibody was raised using the middle region of RAVER1 corresponding to a region with amino acids ALLQLALQTQGQKKPGILGDSPLGALQPGAQPANPLLGELPAGGGLPPEL

CRISPR/Cas9 Monoclonal Antibody (HRP)

SQSTM1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets TNF-α, collagen, and other proteins involved in various cellular processes. This neutralizing antibody can inhibit the activity of growth factors such as TGF-beta and promote lysis of targeted cells. SQSTM1 antibody has shown promising results in studies involving anti-ACTH antibodies, adalimumab, trastuzumab, and inhibitors of epidermal growth factor. Its specificity and effectiveness make it a valuable tool for researchers studying protein-protein interactions and investigating the role of certain proteins in disease pathways.

Luteinizing hormone beta antibody (HRP) was raised in mouse using human LH beta subunit as the immunogen.

LHC-165 is a biodegradable polymer drug that targets the tumor microenvironment. LHC-165 has been shown to induce myeloid-derived suppressor cells (MDSCs) and inhibit TGF-β signaling. MDSCs are immunosuppressive cells that have been implicated in tumor progression and resistance to therapy, as well as in postoperative recurrence of cancer. The mechanism of action of LHC-165 is mediated by toll-like receptor 4 (TLR4) activation. This leads to an intratumoral accumulation of MDSCs and an intraoperative reduction in their number. In addition, LHC-165 has been shown to be effective for the treatment of colorectal cancer when used with resection or radiation therapy.

LKM-1 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about LKM-1 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

4-(2-Chlorobenzyl)-1-(2-hydroxy-3-methoxyphenyl)-(1,2,4)triazolo(4,3-A)quinazolin-5(4H)-one is a peptide used as a research tool. It can activate protein kinase C, thereby inhibiting the activation of ion channels and the opening of calcium channels. It also inhibits protein interactions with other proteins such as receptors and ligands. This compound has been shown to be an inhibitor of receptor binding for Ligand Binding Assays (LBA). 4-(2-Chlorobenzyl)-1-(2-hydroxy-3-methoxyphenyl)-(1,2,4)triazolo(4,3-A)quinazolin-5(4H)-one has also been shown to inhibit cell proliferation in vitro and in vivo.

ING3 antibody was raised in Rabbit using Human ING3 as the immunogen

GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK

Peptide H-LTFGWCFKLVPVEPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LTFGWCFKLVPVEPE-OH include the following: Autologous HIV-1 Clade-B Nef Peptides Elicit Increased Frequency, Breadth and Function of CD8+ T-Cells Compared to Consensus Peptides M Doroudchi, O Yegorov, T Baumgartner - PloS one, 2012 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0049562 Autologous HIV-1 Clade-B Nef Peptides Elicit Increased Frequency M Doroudchi, O Yegorov, T Baumgartner - 2012 - academia.eduhttps://www.academia.edu/download/31011383/journal.pone.0049562.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of WT1 antibody, catalog no. 70R-8233

Ferritin Goat Polyclonal Antibody, IgG Fraction is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Ferritin Goat Polyclonal Antibody, IgG Fraction including the price, delivery time and more detailed product information at the technical inquiry form on this page.

H-TLYKMGFPE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLYKMGFPE-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLYKMGFPE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLYKMGFPE-OH at the technical inquiry form on this page

Mouse monoclonal PAX4 antibody

Mouse monoclonal FCGR2A antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MDH2 antibody, catalog no. 70R-1090

ELISA kit for detection of TIE2 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of MYD88 antibody, catalog no. 70R-5825

Please enquire for more information about Fenpipramide including the price, delivery time and more detailed product information at the technical inquiry form on this page

PNMA3 antibody was raised using the middle region of PNMA3 corresponding to a region with amino acids RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR

A synthetic peptide for use as a blocking control in assays to test for specificity of FADS1 antibody, catalog no. 70R-7011

Peptide H-RVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RVYIHPF-OH include the following: The effect of the secondary structure on dissociation of peptide radical cations: Fragmentation of angiotensin III and its analogues Z Yang , C Lam, IK Chu , J Laskin - The Journal of Physical , 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jp805226x Substrate Protection in Controlled Enzymatic Transformation of Peptides and Proteins Y Zhao - ChemBioChem, 2021 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.202100217 Tautomerization and dissociation of molecular peptide radical cations X Mu, T Song, CK Siu , IK Chu - The Chemical Record, 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/tcr.201700013 Sequence-Selective Protection of Peptides from Proteolysis X Li , K Chen, Y Zhao - Angewandte Chemie International , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/anie.202102148 Mobile and localized protons: a framework for understanding peptide dissociation VH Wysocki , G Tsaprailis, LL Smith - Journal of Mass , 2000 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/1096-9888(200012)35:12%3C1399::AID-JMS86%3E3.0.CO;2-R N-terminal alpha-ketoamide peptides: formation and transamination SH Lee, H Kyung, R Yokota, T Goto - Chemical Research in , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/tx400469x Absorption of casein antihypertensive peptides through an in vitro model of intestinal epithelium M del Mar Contreras , AI Sancho , I Recio, C Mills - Food Digestion, 2012 - Springerhttps://link.springer.com/article/10.1007/s13228-012-0020-2 Fragmentation of doubly-protonated peptide ion populations labeled by H/D exchange with CD3OD KA Herrmann, K Kuppannan, VH Wysocki - International journal of mass , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380606000170 Effect of the basic residue on the energetics, dynamics, and mechanisms of gas-phase fragmentation of protonated peptides J Laskin , Z Yang , T Song, C Lam - Journal of the American , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja104438z Energetics and Dynamics of Electron Transfer and Proton Transfer in Dissociation of MetalIII(salen)−Peptide Complexes in the Gas Phase J Laskin , Z Yang , IK Chu - Journal of the American Chemical , 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja077690s Fragmentation of alpha-radical cations of arginine-containing peptides J Laskin , Z Yang , CMD Ng, IK Chu - Journal of the American Society for , 2010 - Springerhttps://link.springer.com/article/10.1016/j.jasms.2009.12.021 Energy and entropy effects in dissociation of peptide radical anions J Laskin , Z Yang , C Lam, IK Chu - International Journal of Mass , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S138738061200022X Charge-remote fragmentation of odd-electron peptide ions J Laskin , Z Yang , C Lam, IK Chu - Analytical chemistry, 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac070777b Energetics and dynamics of dissociation of deprotonated peptides: Fragmentation of angiotensin analogs J Laskin , Z Yang - International Journal of Mass Spectrometry, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380611002570 Mechanisms of peptide fragmentation from time-and energy-resolved surface-induced dissociation studies: Dissociation of angiotensin analogs J Laskin , TH Bailey, JH Futrell - International Journal of Mass Spectrometry, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380605002836 Fragmentation energetics for angiotensin II and its analogs from time-and energy-resolved surface-induced dissociation studies J Laskin , TH Bailey, JH Futrell - International Journal of Mass Spectrometry, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380604001174 Mechanistic and Energetic Studies of Radical Peptides by means of FT-ICR SID MS J Laskin - Summer Research Institute Interfacial and Condensed , 2006 - osti.govhttps://www.osti.gov/servlets/purl/957371#page=159 Conversion of arginine to ornithine for improving the fragmentation pattern of peptides labeled with the N-terminal tris (2, 4, 6-trimethoxyphenyl) phosphonium group in H Kuyama , C Nakajima, T Nakazawa - Analytical methods, 2010 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2010/ay/c0ay00439a A mechanistic investigation of the enhanced cleavage at histidine in the gas-phase dissociation of protonated peptides G Tsaprailis, H Nair, W Zhong , K Kuppannan - Analytical , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac034971j Intermolecular condensation products formed during the pyrolysis of peptides C Liu, F Basile - Journal of analytical and applied pyrolysis, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165237011001045 The angiotensin IV analog Nle-Tyr-Leu-ψ-(CH2-NH2) 3-4-His-Pro-Phe (Norleual) can act as a hepatocyte growth factor/c-Met inhibitor BJ Yamamoto, PD Elias, JA Masino, BD Hudson - of Pharmacology and , 2010 - ASPEThttps://jpet.aspetjournals.org/content/333/1/161.short

6-Chloro-4-methyl-umbelliferyl β-d-glucoronide

1,2-O-Isopropylidene-β-L-idofuranuronic acid, γ-lactone

Hydroxy-PEG3-NHS

Please enquire for more information about TAP1 Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal IKK gamma antibody

COLEC12 antibody was raised in rabbit using the middle region of COLEC12 as the immunogen

Ropizine is a drug that is used as a diagnostic agent for cardiac arrhythmia. It has been shown to be effective against atrial fibrillation and ventricular tachycardia, with an effect onset of about one minute. Ropizine works by blocking the uptake of catecholamines into the heart muscle cells, which leads to reduced levels of catecholamine-induced cardiac arrhythmias. Ropizine has been shown to be effective in animal models and has potential as a therapeutic agent for human use.