Biochemicals and Reagents

Peptide H-VAIDAGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VAIDAGYR^-OH include the following: Quantitative analysis of the human AKR family members in cancer cell lines using the mTRAQ/MRM approach S Zhang , B Wen , B Zhou, L Yang, C Cha - Journal of Proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr301153z

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD54B antibody, catalog no. 70R-5653

A synthetic peptide for use as a blocking control in assays to test for specificity of Abcf1 antibody, catalog no. 70R-8566

Mouse monoclonal DCK antibody

Peptide H-IQEVAGSLIFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IQEVAGSLIFR-OH include the following: Heparanase interacts with resistin and augments its activity D Novick, S Barak, N Ilan, I Vlodavsky - PloS one, 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0085944

Mouse anti Human IgE antibody

Mouse monoclonal BUB1B antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of NR2C2 antibody, catalog no. 70R-5229

Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP

Affinity Purified Donkey anti-Sheep IgG h+l Antibody

Peptide H-HKKKHPDASV^NFSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HKKKHPDASV^NFSE-OH include the following: Quantification of serum high mobility group box 1 by liquid chromatography/high-resolution mass spectrometry: implications for its role in immunity, inflammation, and L Weng, L Guo , A Vachani, C Mesaros - Analytical , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.8b01175

Rabbit polyclonal RAD23A antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Morf4l1 antibody, catalog no. 70R-8722

CNOT2 antibody was raised in Rabbit using Human CNOT2 as the immunogen

Potent and specific inhibitor of the tyrosine protein kinase Mer precursor (MERTK) with 38-fold selectivity over the FMS-like protein kinase FLT3. UNC 4203 inhibits MERTK with an IC50 value of 2.4 nM and shows favourable pharmacokinetic properties. In vivo experiments in mice showed that UNC 4203 dramatically decreased the phosphorylation of MERTK in bone marrow leukemia cells.

E6446 is a small molecule that has been shown to have antimicrobial activity against a range of microorganisms, including bacterial, fungal and viral pathogens. It also inhibits the production of proinflammatory cytokines and chemokines in vitro. E6446 has been shown to be effective in vivo in an experimental model for inflammatory bowel disease (IBD). The drug does not cross the blood-brain barrier, so it does not affect the central nervous system or cause neurological side effects. E6446 is being studied as a potential treatment for ventricular dysfunction and other conditions associated with chronic inflammation. E6446 is not active against gram-positive bacteria such as Staphylococcus aureus or Streptococcus pneumoniae.

Mouse monoclonal BSA antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PCBP1 antibody, catalog no. 70R-4995

H-QLCRLEQL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QLCRLEQL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QLCRLEQL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QLCRLEQL-OH at the technical inquiry form on this page

RNF128 antibody was raised in rabbit using the C terminal of RNF128 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PPAT antibody, catalog no. 70R-2079

Serotonin antibody was raised in mouse using 5-Hydroxytryptamine hydrochloride as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of FYN antibody, catalog no. 70R-5772

Digoxin is used in several cardiac pathologies such as atrial fibrillation and heart failure. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

H-YLQNQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YLQNQK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YLQNQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YLQNQK-OH at the technical inquiry form on this page

T2AA hydrochloride is a molecule that inhibits the activity of the p21 protein. This protein is involved in cell cycle regulation, and its inhibition could be beneficial for cancer treatment. T2AA hydrochloride is non-classical in structure and has been shown to inhibit prostate cancer cells by binding to their nuclear DNA. It also inhibits the secretion of phospholipase A2, which may be an important mechanism for its antitumor effects. T2AA hydrochloride binds to the receptor site on human secretory phospholipase A2, thereby inhibiting its activity. T2AA hydrochloride has been shown to inhibit viral replication through its interaction with Rna polymerase, which may lead to new treatments for some types of cancer.

Anti-phospho-HtrA2 (pS400) antibody

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Mouse monoclonal CAT antibody

ETHE1 antibody was raised in rabbit using the middle region of ETHE1 as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Ac-KLETADLK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-KLETADLK-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-KLETADLK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-KLETADLK-NH2 at the technical inquiry form on this page

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GEGGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GEGGPQGPR^-OH include the following: Mass Spectrometric Identification of Adhesive Utilized in a Tian-tsui Tiara of the mid-Qing Dynasty (1776-1839 CE) in the Collection of the Tang Clan Folk Museum Z Zhu, P Tan , J Yang, H Ge, L Liu - Studies in Conservation, 2019 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/00393630.2018.1501961 Targeted proteomics for the analysis of cultural heritage: application of broadband collision-induced dissociation mass spectrometry Y Dubrovskii , T Krivul'ko, L Gavrilenko - Analytical and , 2022 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03805-7 Proteomic Analysis of Collagen: a Mass Spectrometry Approach to Material Identification of Shadow Puppet Cultural Relics Y Duan, M Zhang, C Min, Y Lin, L Li - Applied Biochemistry and , 2024 - Springerhttps://link.springer.com/article/10.1007/s12010-023-04822-1 The Application Of Analytical Methods For Analysis Of Non-Halal Components In Cosmetics Products: A Review. A ROHMAN , A WINDARSIH - International Journal of , 2020 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=09752366&AN=148551883&h=cPDAxxf5%2B%2FziMCnIFzjob5tFYPkMw85aPPbzHvBfHBxq6qeXVAOjom4GhPYT9TBAKAUdDB7fLK0VoIXIKUiQoA%3D%3D&crl=c

Syk Inhibitor is a small molecule compound designed to inhibit the activity of spleen tyrosine kinase (Syk), which is derived through advanced chemical synthesis from a variety of organic substrates. With its mode of action as a kinase inhibitor, Syk Inhibitor functions by specifically binding to the ATP-binding site of the Syk enzyme. This binding effectively blocks the phosphorylation processes necessary for signal transduction pathways that are critical in immune cell activation and function. The primary applications of Syk Inhibitor are in research focused on inflammatory diseases, autoimmune disorders, and certain types of cancer. By modulating the aberrant or hyperactive signaling through inhibition of Syk, researchers are able to better understand the pathological mechanisms at play in these diseases. It serves as a crucial tool in the development of potential therapeutic strategies and can also be employed in studying cellular processes such as proliferation and apoptosis. In the context of cancer research, Syk Inhibitor enables the study of tumor cell survival pathways and can aid in the discovery of novel cancer treatment modalities.

Rabbit polyclonal STX18 antibody

Purified recombinant RPL18A protein (His tag)

22-362 amino acids: MGSSHHHHHH SSGLVPRGSH MRENILFGMG NPLLDISAVV DKDFLDKYSL KPNDQILAED KHKELFDELV KKFKVEYHAG GSTQNSIKVA QWMIQQPHKA ATFFGCIGID KFGEILKRKA AEAHVDAHYY EQNEQPTGTC AACITGDNRS LIANLAAANC YKKEKHLDLE KNWMLVEKAR VCYIAGFFLT VSPESVLKVA HHASENNRIF TLNLSAPFIS QFYKESLMKV MPYVDILFGN ETEAATFARE QGFETKDIKE IAKKTQALPK MNSKRQRIVI FTQGRDDTIM ATESEVTAFA VLDQDQKEII DTNGAGDAFV GGFLSQLVSD KPLTECIRAG HYAASIIIRR TGCTFPEKPD FH

Catalogue peptide; min. 95% purity

Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.

Peptide H-VTSIQ^D^WV^Q^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VTSIQ^D^WV^Q^K^-OH include the following: Differentially expressed haptoglobin as a potential biomarker for type 2 diabetic mellitus in Hispanic population Z Liu , D Feng , D Gu, R Zheng, C Esperat, W Gao - BioFactors, 2017 - Wiley Online Libraryhttps://iubmb.onlinelibrary.wiley.com/doi/abs/10.1002/biof.1352 Serum proteomic biomarkers diagnostic of knee osteoarthritis VB Kraus , A Reed, EJ Soderblom, YM Golightly - Osteoarthritis and , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1063458423009202 Assessment of the influence of the patient's inflammatory state on the accuracy of a haptoglobin selected reaction monitoring assay O Lassout, D Hochstrasser, P Lescuyer - Clinical proteomics, 2014 - Springerhttps://link.springer.com/article/10.1186/1559-0275-11-38 Urine haptoglobin levels predict early renal functional decline in patients with type 2 diabetes NM Bhensdadia, KJ Hunt, MF Lopes-Virella - Kidney international, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0085253815558869 Quantitation of 87 proteins by nLC-MRM/MS in human plasma: workflow for large-scale analysis of biobank samples M Rezeli , K Sjödin, H Lindberg - Journal of proteome , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.7b00235 Diagnostic protein discovery using liquid chromatography/mass spectrometry for proteolytic peptide targeting JM Koomen , H Zhao, D Li , W Nasser - Journal Devoted to , 2005 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.1963 A proteogenomic analysis of haptoglobin in malaria G Awasthi , S Tyagi , V Kumar , SK Patel - PROTEOMICS , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201700077