Biochemicals and Reagents

Tos-PEG5-CH2CO2t-butyl ester

Rabbit polyclonal ORC1L antibody

4-Methylumbelliferyl-α-D-galactopyranoside

WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

Rabbit polyclonal ZAP70 antibody (Tyr493)

The ANT2 antibody is a highly activated nuclear antibody that has been developed as an inhibitor for various immunoassays. It specifically targets neurotrophic factors and can be used as a monoclonal antibody in research and diagnostic applications. Additionally, the ANT2 antibody has shown inhibitory properties against TGF-β1, chemokines, and TNF-α. Its neutralizing capabilities make it a valuable tool for studying the effects of these factors on cellular processes. With its immobilization potential and anti-CD33 antibody properties, the ANT2 antibody offers researchers a versatile option for their experiments.

A synthetic peptide for use as a blocking control in assays to test for specificity of AURKA antibody, catalog no. 70R-7853

Inhibitor of BACE1 protease

Rat monoclonal CD45R antibody

Peptide H-RGLYFPAGGSSSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RGLYFPAGGSSSG-OH include the following: Interferon-γ facilitates hepatic antiviral T cell retention for the maintenance of liver-induced systemic tolerance Z Zeng, L Li, Y Chen, H Wei, R Sun - Journal of Experimental , 2016 - rupress.orghttps://rupress.org/jem/article-abstract/213/6/1079/42080 Th1-LIKE HBV-SPECIFIC CD4+ T CELLS ARE ABLE TO REVERT THE CD8+ T CELL DYSFUNCTION INDUCED BY HEPATOCELLULAR PRIMING V Venzin - 2023 - iris.unisr.ithttps://iris.unisr.it/handle/20.500.11768/137016 Plasmid vector-linked maturation of natural killer (NK) cells is coupled to antigen-dependent NK cell activation during DNA-based immunization in mice R Zhu, M Mancini-Bourgine, XM Zhang - Journal of , 2011 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.00062-11 Synthetic innate defense regulator peptide combination using CpG ODN as a novel adjuvant induces long"‘lasting and balanced immune responses CH Yu, ZC Luo , M Li, L Lu, Z Li - Molecular , 2016 - spandidos-publications.comhttps://www.spandidos-publications.com/10.3892/mmr.2015.4581?text=abstract Interleukin-22 as a molecular adjuvant facilitates IL-17-producing CD8+ T cell responses against a HBV DNA vaccine in mice B Wu , Q Zou , Y Hu, B Wang - Human Vaccines & , 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/hv.26047 Identification of novel HLA-DR1-restricted epitopes from the hepatitis B virus envelope protein in mice expressing HLA-DR1 and vaccinated human subjects A Pajot, ML Michel, M Mancini-Bourgine - Microbes and , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1286457906003042

Rat sequence expressed in E. coli Cells; purity >98% by SDS-PAGE and HPLC.

α-Gliadin (58-73) is derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th1-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.

BRF1 antibody was raised in mouse using recombinant Brf1 Homolog, Subunit Of Rna Polymerase Iii Transcription Initiation Factor Iiib (S. Cerevisiae) (Brf1)

Rabbit polyclonal CTDNEP1 antibody (FITC)

Rabbit polyclonal GluR1 antibody

Region of GM-CSF protein corresponding to amino acids MAPTRSPITV TRPWKHVEAI KEALNLLDDM PVTLNEEVEV VSNEFSFKKL TCVQTRLKIF EQGLRGNFTK LKGALNMTAS YYQTYCPPTP ETDCETQVTT YADFIDSLKT FLTDIPFECK KPVQK.

H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Affinity purified Rabbit polyclonal NOSIP antibody

Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLLKLTPLL-OH include the following: Allo-HLA-reactive T cells inducing graft-versus-host disease are single peptide specific AL Amir, DM van der Steen- Blood, The Journal ..., 2011 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/118/26/6733/29417

Purified Rabbit polyclonal VAV3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2A7 antibody, catalog no. 70R-7502