Biochemicals and Reagents

Purified Polyclonal SOCS1 antibody

Rabbit polyclonal 4EBP1 antibody (Thr69)

Mouse monoclonal C17orf37 antibody

EIF2C2 antibody was raised in Rabbit using Human EIF2C2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of C5orf39 antibody, catalog no. 70R-2188

Quantify total bovine IgA in your samples.

MATR3 antibody was raised in Rabbit using Human MATR3 as the immunogen

RSV antibody was raised in rabbit using residues 187-198 LCKSICKTIPSNKPKKKP of the RSV G protein B1 strain as the immunogen.

PREP antibody was raised using the N terminal of PREP corresponding to a region with amino acids THDGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEF

Propargyl-PEG3-CH2CO2H

H-LVATVKEAGRSIHEIPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LVATVKEAGRSIHEIPR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LVATVKEAGRSIHEIPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LVATVKEAGRSIHEIPR-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RRM2 antibody, catalog no. 70R-5609

Purified recombinant Human CIAPIN1 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of ACLY antibody, catalog no. 70R-3904

H-FCFASGQNITEEFYQST-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FCFASGQNITEEFYQST-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FCFASGQNITEEFYQST-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FCFASGQNITEEFYQST-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of STK11 antibody, catalog no. 70R-1135

Mouse monoclonal HARS2 antibody

Please enquire for more information about Cy5 SE(tri SO3) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-DSTGSFVLPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSTGSFVLPFR^-OH include the following: Arthur Viode1, Clemence Fournier2, 3, Agnacašs Camuzat2, 4, Franaca§ois Fenaille1, NeuroCEB Brain Bank, Morwena Latouche2, 4, Fanny Elahi5, Isabelle Le Ber2, 3, 6 LP Sugrue - Genetics of Neurodegenerative Diseases, 2021 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=O8JSEAAAQBAJ&oi=fnd&pg=PA75&dq=(%22DSTGSFVLPFR%22+OR+%22DSTGSFVLPFR%5E%22+OR+%22H-DSTGSFVLPFR%5E-OH%22+OR+%22H-DSTGSFVLPFR-OH%22)+AND+peptide&ots=ZjyONTXIp9&sig=gEJ0MEzPy6WzDOgU6jUU6f5AxMQ New antibody-free mass spectrometry-based quantification reveals that C9ORF72 long protein isoform is reduced in the frontal cortex of hexanucleotide-repeat A Viode, C Fournier, A Camuzat, F Fenaille - Frontiers in , 2018 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fnins.2018.00589/full

Mouse monoclonal PPM1B antibody

Rabbit anti-mouse IgG3 was raised in rabbit using murine IgG3 heavy chain as the immunogen.

Rabbit polyclonal MET antibody

Rabbit polyclonal SYT17 antibody

The CEA antibody is a monoclonal antibody that has cytotoxic properties. It is designed to specifically target and bind to carcinoembryonic antigen (CEA), a protein that is often overexpressed in certain types of cancer cells. By binding to CEA, the antibody triggers an immune response that leads to the destruction of cancer cells. This monoclonal antibody is highly specific and exhibits strong antigen-antibody reactions with CEA. It is produced using advanced techniques in the field of Life Sciences, ensuring its purity and effectiveness. The CEA antibody can be used for various applications, including quantitation of CEA levels in human serum, as well as for research purposes such as studying protein kinase signaling pathways. In addition to its cytotoxic effects, this monoclonal antibody also possesses neutralizing properties against certain antigens. This makes it a valuable tool for researchers studying the function and interaction of specific proteins in various cellular processes. The CEA antibody is available in a convenient

Rabbit polyclonal Caspase 7 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of THEX1 antibody, catalog no. 70R-1307

Peptide H-RRSLGHPEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RRSLGHPEP-OH include the following: Brain expression of presenilins in sporadic and early-onset, familial Alzheimer's disease PM Mathews, AM Cataldo, BH Kao, AG Rudnicki - Molecular , 2000 - Springerhttps://link.springer.com/article/10.1007/BF03401825

P53 Monoclonal Antibody (FITC)

Purified recombinant CFP protein (His tag)

Purified native Human VWF protein (Factor VIII Free)

Rabbit polyclonal Ceruloplasmin antibody (HRP)

Please enquire for more information about Fmoc-Trp-Rink-Amide MBHA Resin including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-CKNIQWKERSKQSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CKNIQWKERSKQSA-OH include the following: mTORC2 activity is elevated in gliomas and promotes growth and cell motility via overexpression of rictor J Masri, A Bernath, J Martin, OD Jo, R Vartanian - Cancer research, 2007 - AACRhttps://aacrjournals.org/cancerres/article-abstract/67/24/11712/534551 Mip1, an MEKK2-interacting protein, controls MEKK2 dimerization and activation J Cheng, D Zhang, K Kim, Y Zhao - Molecular and cellular , 2005 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1128/MCB.25.14.5955-5964.2005

CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD

Please enquire for more information about NSE antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK1 antibody, catalog no. 70R-5420

LIAS antibody was raised in Rabbit using Human LIAS as the immunogen

Peptide H-IDTTIGEWAFWETKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IDTTIGEWAFWETKK-OH include the following: Vaccination with recombinant adenoviruses expressing Ebola virus glycoprotein elicits protection in the interferon alpha/beta receptor knock-out mouse LM O'Brien, MG Stokes, SG Lonsdale, DR Maslowski - Virology, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682213001815

Teicoplanin

A synthetic peptide for use as a blocking control in assays to test for specificity of EWSR1 antibody, catalog no. 70R-5013