Biochemicals and Reagents

Streptavidin antibody was raised in mouse using the streptavidin molecule of Streptomyces avidinii as the immunogen.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Please enquire for more information about (S,S)- Formoterol 2-benzyl including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-LHGGSPWPPCQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LHGGSPWPPCQYR-OH include the following: Inhibition of degranulation of polymorphonuclear leukocytes by angiogenin and its tryptic fragment. H Tschesche, C Kopp, WH Hörl- Journal of Biological ..., 1994 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)43808-2/fulltext

Mouse monoclonal ARCN1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of IMPAD1 antibody, catalog no. 70R-6370

Please enquire for more information about Anti-Kat2 antibody - 2mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Polyclonal Ephrin B1 antibody

Mouse monoclonal West Nile virus antibody

VEGFR-2-IN-6 is a high purity peptide that contains a ligand that can bind to VEGFR-2. This peptide can be used as a research tool in the study of cancer cells and their interactions with VEGFR-2 receptors. The receptor is found on endothelial cells and mediates many biological processes, including the growth of new blood vessels. The activator of this receptor is VEGF, which activates this receptor by binding to it. The binding of VEGF to the receptor causes activation of phosphatidylinositol 3-kinase (PI3K) which leads to increased production of nitric oxide synthase (NOS), leading to increased production of nitric oxide (NO). NO activates guanylate cyclase, leading to an increase in intracellular cyclic guanosine monophosphate (cGMP) levels and vasodilation.

Losmiprofen is a non-steroidal anti-inflammatory drug (NSAID) synthesized through pharmaceutical chemical processes. It is structurally designed to inhibit cyclooxygenase (COX) enzymes, which play a key role in the conversion of arachidonic acid to prostaglandins. Prostaglandins are lipid compounds that exacerbate inflammation, pain, and fever. By selectively acting on the COX enzymes, losmiprofen mitigates the synthesis of these mediators, thereby reducing inflammatory responses. The primary clinical applications of losmiprofen include the management of various types of pain and inflammatory conditions. This encompasses its use in alleviating symptoms of osteoarthritis, rheumatoid arthritis, and other musculoskeletal disorders. Its efficacy in managing post-operative pain has also been documented, making it a versatile agent in pain management protocols. The pharmacokinetic profile of losmiprofen facilitates a controlled modulation of inflammatory processes, leading to improved patient outcomes with minimized side effects. Researchers continue to explore its therapeutic potential and optimize its clinical implementation, highlighting the drug's significance in the field of anti-inflammatory pharmacotherapy.

SOD antibody was raised in rabbit using superoxide dismutase from bovine erythrocytes as the immunogen.

1-282 amino acids: MSGADRSPNA GAAPDSAPGQ AAVASAYQRF EPRAYLRNNY APPRGDLCNP NGVGPWKLRC LAQTFATGEV SGRTLIDIGS GPTVYQLLSA CSHFEDITMT DFLEVNRQEL GRWLQEEPGA FNWSMYSQHA CLIEGKGECW QDKERQLRAR VKRVLPIDVH QPQPLGAGSP APLPADALVS AFCLEAVSPD LASFQRALDH ITTLLRPGGH LLLIGALEES WYLAGEARLT VVPVSEEEVR EALVRSGYKV RDLRTYIMPA HLQTGVDDVK GVFFAWAQKV GL

D-Kynurenine free base

TMEM166 antibody was raised in rabbit using the middle region of TMEM166 as the immunogen

UBL7 antibody was raised in rabbit using the N terminal of UBL7 as the immunogen

Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Polyclonal BMP8A antibody

CMV antibody was raised in mouse using 65 kDa protein of cytomegalovirus as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRB3 antibody, catalog no. 70R-5196

Rabbit polyclonal CaMKII antibody

Mouse monoclonal Cytokeratin 4 antibody

ELISA kit for the detection of Human Resistin in the research laboratory

Propargyl-PEG1-SS-alcohol

ILK antibody was raised in Rabbit using Human ILK as the immunogen

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Synthethic MDMA-BSA cojugated hapten

PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT

Peptide H-KRQDILDLWIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KRQDILDLWIY-OH include the following: CD8+ Cytotoxic T Lymphocyte Responses and Viral Epitope Escape in Acute HIV-1 Infection J Kim, J De La Cruz, K Lam, H Ng, ES Daar - Viral , 2018 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2018.0040

Peptide Rhod-FRHDSGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Rhod-FRHDSGY-OH include the following: Role of Interaction between Zinc and Amyloid Beta in Pathogenesis of Alzheimer's Disease SA Kozin - Biochemistry (Moscowhttps://link.springer.com/article/10.1134/S0006297923140055 Zinc binding agonist effect on the recognition of the beta-amyloid (4-10) epitope by anti-beta-amyloid antibodies S Zirah, R Stefanescu , M Manea, X Tian - Biochemical and , 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X04014159 Mass spectrometric approaches for elucidation of antigen-antibody recognition structures in molecular immunology R Stefanescu , RE Iacob , EN Damoc - Journal of Mass , 2007 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1255/ejms.849 Stable accumulation of seed storage proteins containing vaccine peptides in transgenic soybean seeds N Maruyama, K Fujiwara, K Yokoyama - Journal of bioscience , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1389172314001352 Peptide dimer structure in an Abeta (1-42) fibril visualized with cryo-EM M Schmidt, A Rohou , K Lasker - Proceedings of the , 2015 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1503455112 Design, structural, and immuno-analytical properties of antigenic bioconjugates comprising a beta-amyloid-plaque specific epitope M Manea, M Przybylski, F Hudecz , G Mezö - Peptide Science, 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.20916 Polypeptide conjugates comprising a beta-amyloid plaque-specific epitope as new vaccine structures against Alzheimer's disease M Manea, G Mezö , F Hudecz - Peptide Science , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.20160 Mass spectrometric identification of the trypsin cleavage pathway in lysyl-proline containing oligotuftsin peptides M Manea, G MezÅ‘ , F Hudecz - of the European Peptide , 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.836 Synthesis, solution conformation, and antibody recognition of oligotuftsin-based conjugates containing a beta-amyloid (4-10) plaque-specific epitope M Manea, F Hudecz , M Przybylski - Bioconjugate , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc0500037 Antibody recognition and conformational flexibility of a plaque-specific beta-amyloid epitope modulated by non-native peptide flanking regions M Manea, A Kalaszi, G Mezo , K Horvati - Journal of medicinal , 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm070196e studies of the interaction of heparin-derived oligosaccharide with biological molecules and the cis/trans isomerization of amide bonds in peptides and peptide KT Nguyen - 2009 - search.proquest.comhttps://search.proquest.com/openview/c13643d5b35968db857a6347bf62136d/1?pq-origsite=gscholar&cbl=18750 Dendritic compounds as immune response modulators. New approaches for vaccine development J Rojo - Anti-Infective Agents in Medicinal Chemistry (Formerly , 2009 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/aiamc/2009/00000008/00000001/art00006 Determination of primary structure and microheterogeneity of a beta-amyloid plaque-specific antibody using high-performance LC-tandem mass spectrometry I Perdivara, L Deterding, A Moise , KB Tomer - Analytical and , 2008 - Springerhttps://link.springer.com/article/10.1007/s00216-008-1941-z Epitomic characterization of the specificity of the anti-amyloid Abeta monoclonal antibodies 6E10 and 4G8 I Baghallab, JM Reyes-Ruiz , K Abulnaja - Journal of , 2018 - content.iospress.comhttps://content.iospress.com/articles/journal-of-alzheimers-disease/jad180582 Epitope structure and binding affinity of single chain llama anti-beta-amyloid antibodies revealed by proteolytic excision affinity-mass spectrometry G Paraschiv, C Vincke, P Czaplewska - Journal of Molecular , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jmr.2210 Identification of amyloid antibodies for Alzheimer disease-immunotherapy EA Huwait , IM Baghallab, CG Glabe - of physiology and , 2022 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/13813455.2020.1767147 A Peptide Vaccine Based on Retro-Inverso beta-Amyloid Sequences Fails to Elicit a Cross-reactive Immune response E Bianchi, P Ingallinella, M Finotto, X Liang - Peptides for Youth: The , 2009 - Springerhttps://link.springer.com/chapter/10.1007/978-0-387-73657-0_160 Conformational flexibility and 3D QSAR A Kalaszi - 2007 - teo.elte.huhttp://teo.elte.hu/minosites/tezis2007_angol/a_kalaszi.pdf

Rabbit polyclonal SPAG5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of HSP90B1 antibody, catalog no. 70R-5032

Serum amyloid A protein is a neutralizing and reactive protein that plays a crucial role in various life sciences applications. It acts as a growth factor and can be used in buffered solutions for research purposes. Serum amyloid A protein interacts with calmodulin and can be detected using specific monoclonal antibodies. It has been shown to have immunosuppressant properties and can inhibit the activity of influenza hemagglutinin. Recombinant forms of serum amyloid A protein are available for use in experiments, providing a reliable source of this important protein. Researchers studying amyloid-related diseases may find serum amyloid A protein particularly valuable for their studies.

3,4-Dichloro-N-[1-(3,4-dichlorophenyl)-1,3,4,9-tetrahydropyrido[3,4-b]indol-2-yl]benzamide (DAPA) is a ligand that binds to the ion channel TRPV1. DAPA is a research tool for studying the function of ion channels in cells. The protein interactions of DAPA have been studied using a variety of techniques such as peptides and antibodies. Inhibiting TRPV1 channels with DAPA has shown to reduce inflammation and pain in mice.

The peptide AM-211 is a potent activator of the TRPV1 receptor, which is expressed in sensory neurons. This receptor is activated by heat and capsaicin, and mediates pain sensation. AM-211 has been shown to inhibit voltage-gated sodium channels, which are involved in the generation of action potentials. It also binds to the extracellular domain of the Nogo receptor and blocks its interaction with its ligands. TRPV1 receptors have been implicated in various diseases such as chronic pain, inflammatory bowel disease, diabetes mellitus type 2, osteoarthritis and rheumatoid arthritis.

S 18986 is a novel molecule that binds to the glutamate receptor. It has been shown to protect neurons against glutamate-induced cell death in vitro and in vivo, as well as reversing memory deficits in aged mice. S 18986 also increases the production of neurotrophic factors and enhances neuronal function. The pharmacokinetics of S 18986 have been studied using a population modeling approach. This approach provides an asymmetric synthesis route for the preparation of this compound. S 18986 has also been shown to increase locomotor activity, which may be due to its ability to potentiate GABAergic transmission.END>

Purified Polyclonal CXCL12 antibody

Please enquire for more information about MTB-D1 including the price, delivery time and more detailed product information at the technical inquiry form on this page

[5-FAM]-TAT (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). Specifically TAT (47-57) is located within the arginine-rich basic domain 48-60 of the TAT peptide which as a whole has three domains which function to aid HIV through transactivation, DNA binding and nuclear transport. As a cell penetrating peptide (CPP) TAT aids in the cellular uptake of molecules and hence serves a valuable purpose in transduction methods. This property has been demonstrated through its ability of allowing toxins such as the neurotoxin Botulinum neurotoxin Type A, produced by the Clostridium botulinum type A bacteria to penetrate the skin barrier non-invasively. Additionally TAT (47-57) can be used to deliver proteins, fluorophores, chelators and DNA to target cells.It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

Parsaclisib is a secretase inhibitor that has been shown to be effective in treating multiple types of cancer, including lung, pancreatic, and colorectal cancers. It is also being investigated for use in the treatment of Alzheimer's disease and other autoimmune diseases. Parsaclisib inhibits the production of amyloid beta protein by reducing its production by inhibiting the enzyme β-secretase. This drug has been shown to increase glomerular filtration rate (GFR) in patients with chronic kidney disease. Parsaclisib is a promising drug for the treatment of infectious diseases such as HIV/AIDS because it suppresses viral replication without affecting normal cells.

Gliadin protein is a low-density protein that plays a crucial role in the field of Life Sciences. It falls under the category of Native Proteins & Antigens and is widely used in research studies. Gliadin protein has unique characteristics that make it highly valuable for scientific investigations. It can be used as a target for antibodies, including c-myc antibodies, to study its interaction with other molecules such as nucleotides. Additionally, gliadin protein has been found to have nuclear localization and may play a role in regulating gene expression. Moreover, gliadin protein has been shown to interact with growth factors like trastuzumab and epidermal growth factor (EGF). These interactions suggest potential involvement in signaling pathways related to tyrosine kinase receptors. Furthermore, gliadin protein has been studied for its inhibitory effects on tyrosine kinase activity. In recent years, there has also been interest in the association between gliadin protein and alpha-synuclein, a protein involved

ADSL antibody was raised in rabbit using the middle region of ADSL as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SCN5A antibody, catalog no. 70R-5112

UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG

A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD47 antibody, catalog no. 70R-4426