Biochemicals and Reagents

Mouse monoclonal LSM2 antibody

Purified Polyclonal BRAF antibody

Fibronectin Adhesion-Promoting Peptide is a polyclonal antibody that recognizes fibronectin, a glycoprotein found in the extracellular matrix. Fibronectin promotes cell adhesion and proliferation by binding to collagen. This antibody can be used to detect fibronectin in tissues from patients with cancer. It may also be used as a tool for identifying cancer cells that have metastasized to other sites in the body.

Mycoplasma pneumoniae antibody is a product used in Life Sciences research to study protein-protein interactions. It is a monoclonal antibody that specifically targets and binds to Mycoplasma pneumoniae, a bacterium known to cause respiratory infections. The antibody can be used in various applications such as immunohistochemical detection, fluorescence immunochromatography, and polymerase chain reactions. It is highly specific and sensitive, making it an ideal tool for detecting the presence of Mycoplasma pneumoniae in samples such as human serum or cell cultures. This antibody can also be used to study the role of Mycoplasma pneumoniae in autoimmune diseases by investigating the presence of autoantibodies. Its high affinity for Mycoplasma pneumoniae antigens ensures accurate and reliable results in research experiments.

Affinity purified Rabbit polyclonal Lipocalin 1 antibody

Mouse monoclonal UBXN10 antibody

BTG1 antibody was raised in mouse using recombinant Human B-Cell Translocation Gene 1, Anti-Proliferative (Btg1)

Purified recombinant Human TARS protein (His tag)

Peptide Ac-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CR-NH2 include the following: Graphene oxide-cyclic R10 peptide nuclear translocation nanoplatforms for the surmounting of multiple-drug resistance Z Tu , IS Donskyi , H Qiao , Z Zhu - Advanced Functional , 2020 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adfm.202000933 Efficient delivery of cyclic peptides into mammalian cells with short sequence motifs Z Qian , T Liu , YY Liu, R Briesewitz - ACS chemical , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/cb3005275 Cation recognition by self-assembled monolayers of oriented helical peptides having a crown ether unit Y Miura , S Kimura, S Kobayashi, Y Imanishi - Peptide , 2000 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1097-0282(2000)55:5%3C391::AID-BIP1013%3E3.0.CO;2-K Urea-modified metal-organic framework of type MIL-101 (Cr) for the preconcentration of phosphorylated peptides X Yang, Y Xia - Microchimica Acta, 2016 - Springerhttps://link.springer.com/article/10.1007/s00604-016-1860-1 Quantifying amyloid beta-peptide (Abeta) aggregation using the Congo Red-Abeta (CR-Abeta) spectrophotometric assay WE Klunk , RF Jacob, RP Mason - Analytical biochemistry, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269798929335 A highly selective and sensitive peptide-based probe for the colorimetric and fluorescent detection of Fe3+, Al3+ and Cr3+ and its application in living cells imaging W Deng, Y Gou, Q Zhang, P Li, P Wang - Journal of Luminescence, 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022231324000061 Investigation of self-assembly upon formation of an electrostatic complex of Congo red and a helical peptide TM Cooper, MO Stone - Langmuir, 1998 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/la9806911 Enhanced and selective adsorption of cationic dyes using novel biocompatible self-assembled peptide fibrils SK Brar , N Wangoo , RK Sharma - Journal of environmental management, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0301479719315221 Spectroscopic investigation on gel-forming beta-sheet assemblage of peptide derivatives S Ganesh , S Prakash - : Original Research on , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.10493 Chromium (V) peptide complexes: synthesis and spectroscopic characterization PJ Barnard , A Levina , PA Lay - Inorganic chemistry, 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ic048322h Peptide-based biocoatings for corrosion protection of stainless steel biomaterial in a chloride solution NGG Muruve, YF Cheng , Y Feng , T Liu - Materials Science and , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0928493116306221 Analysis of Metal Effects on C-Peptide Structure and Internalization MJ Stevenson , IC Farran , KS Uyeda - , 2019 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.201900172 Self-Assembling Diblock Copolymers of Poly[N-(2-hydroxypropyl)methacrylamide] and a beta-Sheet Peptide LC Radu, J Yang , J Kopeček - Macromolecular bioscience, 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/mabi.200800193 Dual electro-/pH-responsive nanoparticle/hydrogel system for controlled delivery of anticancer peptide L Resina , T Esteves , S Perez-Rafael, JIH Garcaca­a - Biomaterials , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2772950824001687 Spectroscopic and calorimetric studies of congo red dye-amyloid peptide complexes K Yokoyama , AD Fisher, AR Amori - Journal of , 2010 - publications.article4sub.comhttp://publications.article4sub.com/id/eprint/128/ Effects of Charge and Charge Distribution on the Cellular Uptake of Multivalent Arginine-Containing Peptide-Polymer Conjugates K Koschek , M Dathe, J Rademann - ChemBioChem, 2013 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.201300365 Ligand field properties of the peptide nitrogen: The sharp-line electronic spectrum of mer-di (3-aminopropyl) amine (glycylglycinato-O, N, N')-chromium (III) JH Choi , PE Hoggard - Polyhedron, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0277538700835317 An anti-peptide antibody that recognizes a neo-antigen in the CR1 stump remaining on erythrocytes after proteolysis JE Barbosa, RA Harrison , PJ Barker - Clinical & , 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2249.1992.tb06428.x Spectroscopic characterization of genotoxic chromium (V) peptide complexes: oxidation of chromium (III) triglycine, tetraglycine and pentaglycine complexes HA Headlam, PA Lay - Journal of inorganic biochemistry, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0162013416301787 EPR spectroscopic studies of the reduction of chromium (VI) by methanol in the presence of peptides. Formation of long-lived chromium (V) peptide complexes HA Headlam, PA Lay - Inorganic Chemistry, 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ic000299m Spectroscopic and biological activity studies of the chromium-binding peptide EEEEGDD H Arakawa, MR Kandadi , E Panzhinskiy - JBIC Journal of , 2016 - Springerhttps://link.springer.com/article/10.1007/s00775-016-1347-x Thermodynamics of solvation of some small peptides in water at T= 298.15 K G Della Gatta , T Usacheva , E Badea , B PaÅ‚ecz - The Journal of Chemical , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021961405002557 Synthesis of Peptide-Oligonucleotide Conjugates for Chromium Coordination ER Civitello , RG Leniek, KA Hossler - Bioconjugate , 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc0100105 Enhanced cellular uptake of short polyarginine peptides through fatty acylation and cyclization D Oh, A Nasrolahi Shirazi , K Northup - Molecular , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/mp500203e An informatics search for the low-molecular weight chromium-binding peptide D Dinakarpandian , V Morrissette, S Chaudhary - BMC Chemical , 2004 - Springerhttps://link.springer.com/article/10.1186/1472-6769-4-2 Effect of peptide chain length on peptide retention behaviour in reversed-phase chromatogrphy CT Mant, TWL Burke, JA Black, RS Hodges - Journal of Chromatography A, 1988 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967300905648 In vitro DNA damage and mutations induced by a macrocyclic tetraamide chromium(V) complex: implications for the role of Cr(V) peptide complexes in chromium CT Dillon, PA Lay , AM Bonin, NE Dixon - , 1993 - academic.oup.comhttps://academic.oup.com/carcin/article-abstract/14/9/1875/334262 Formation of cationic peptide radicals by gas-phase redox reactions with trivalent chromium, manganese, iron, and cobalt complexes CK Barlow , WD McFadyen - Journal of the American , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja043088f Production and characterization of lucrative hypoglycemic collagen-peptide-chromium from tilapia scale CH Wu , HR Guo, AK Patel , RR Singhania , YA Chen - Process , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1359511322000484 Linear short histidine and cysteine modified arginine peptides constitute a potential class of DNA delivery agents A Mann, V Shukla, R Khanduri , S Dabral - molecular , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/mp400353n

Applications Mesitylene, is a precursor to diverse fine chemicals. It is also commonly used as a solvent in the laboratory. Not a dangerous good if item is equal to or less than 1g/ml and there is less than 100g/ml in the package References Girolami, G. S., et al.: Synth. Tech. Inorg. Chem. (1999);

M13/fd/F1 Filamentous Phages antibody (Biotin) was raised in mouse using fd phages from E. coli F+ strain (JM109) as the immunogen.

AGK antibody was raised using the N terminal of AGK corresponding to a region with amino acids KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Mouse monoclonal ACOT7 antibody

Lithium dodecyl sulphate

RFX5 antibody was raised in rabbit using the N terminal of RFX5 as the immunogen

NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

LTC4S antibody was raised in rabbit using the N terminal of LTC4S as the immunogen

Ripretinib is a potent, orally bioavailable inhibitor of the tyrosine kinase activity of RET. It has been shown to be effective in treating gastrointestinal cancer and solid tumours. This drug is metabolized by cytochrome P450 (CYP) enzymes and interacts with other drugs that are CYP substrates. Ripretinib also inhibits the activity of other cellular factors, such as cell factor (CF), which may contribute to its antitumour effects.

Recombinant Mouse AHSG protein with His tag

Rabbit Polyclonal CNTN5 antibody

Rabbit polyclonal PGAM2 antibody

Affinity purified Rabbit polyclonal AKR1C1 antibody

Peptide HATU is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using HATU include the following: Evaluation of lipopeptides as toll-like receptor 2 ligands WM Hussein , PM Choi , C Zhang, M Su - Current drug , 2017 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cdd/2017/00000014/00000007/art00007 New 21-and 24-atom Aib-containing cyclopeptides T Jeremic, A Linden - of the European Peptide , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.1041 Recent development of peptide coupling reagents in organic synthesis SY Han, YA Kim - Tetrahedron, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/abs/pii/S0040402004000651 Preparation, Radiolabeling with 68Ga/177Lu and Preclinical Evaluation of Novel Angiotensin Peptide Analog: A New Class of Peptides for Breast Cancer Targeting SM Okarvi - Pharmaceuticals, 2023 - mdpi.comhttps://www.mdpi.com/1424-8247/16/11/1550 On the use of novel coupling reagents for solid-phase peptide synthesis SA Kates, E Diekmann, A El-Faham , LW Herman - Techniques in Protein , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1080891496800561 Characterization of synthetic peptide byproducts from cyclization reactions using on-line HPLC-ion spray and tandem mass spectrometry S Arttamangkul, B Arbogast, D Barofsky - Letters in Peptide , 1997 - Springerhttps://link.springer.com/article/10.1007/BF00127967 Facile synthesis of peptide nucleic acids and peptide nucleic acid-peptide conjugates on an automated peptide synthesizer R Joshi, D Jha, W Su - Journal of Peptide , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.1305 Applications of peptide coupling reagents-an update P Kvsrg, K Bharathi, B Haseena Banu - Int. J. Pharm. Sci. Rev. Res, 2011 - academia.eduhttps://www.academia.edu/download/34151818/peptide_coupling.pdf Synthesis and purification of amyloidogenic peptides MR Nilsson, LL Nguyen, DP Raleigh - Analytical Biochemistry, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269700948875 Low-Cost, Fast, Conventional Peptide Synthesis With HCTU and Automated Peptide Synthesizers M Menakuru, JH Park - stepbio.ithttps://www.stepbio.it/public/fiere-convegni/Low-Cost%20Fast%20Conventional%20Peptide%20Synthesis.pdf An improved method for the solution cyclization of peptides under pseudo-high dilution conditions M Malesevic, U Strijowski , D Bachle, N Sewald - Journal of biotechnology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168165604002317 Accelerated chemical synthesis of peptides and small proteins LP Miranda, PF Alewood - Proceedings of the National , 1999 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.96.4.1181 An optimised approach for continuous-flow solid-phase peptide synthesis utilising a rudimentary flow reactor LK Spare , V Laude, DG Harman - Reaction Chemistry & , 2018 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/sc/c8re00190a The uronium/guanidinium peptide coupling reagents: finally the true uronium salts LA Carpino, H Imazumi, A El-Faham - Angewandte Chemie , 2002 - users.uniwa.grhttp://users.uniwa.gr/vdourt/research/hbtu.pdf Efficiency in peptide coupling: 1-hydroxy-7-azabenzotriazole vs 3, 4-dihydro-3-hydroxy-4-oxo-1, 2, 3-benzotriazine LA Carpino, A El-Faham , F Albericio - The Journal of Organic , 1995 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/jo00116a054 Microwave-assisted solid-phase peptide synthesis of neurosecretory protein GL composed of 80 amino acid residues K Masuda, H Ooyama, K Shikano - Journal of Peptide , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.2756 Fluorescence Labeling of Peptides: Finding the Optimal Protocol for Coupling Various Dyes to ATCUN-like Structures JCJ Hintzen , S Devrani, AJ Carrod - ACS Organic & , 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsorginorgau.4c00030 Peptide bond-forming reagents H OA t and H ATU are not mutagenic in the bacterial reverse mutation test J Nicolette, RE Neft, J Vanosdol - Environmental and , 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/em.21997 Synthesis of Antioxidant Peptide SCAP1 (Leu-Ala-Asn-Ala-Lys) IR Sabana, M Naufal, I Wiani - Egyptian Journal of , 2020 - ejchem.journals.ekb.eghttps://ejchem.journals.ekb.eg/article_43915.html Convergent solid phase peptide synthesis: an efficient approach to the synthesis of highly repetitive protein domains I Dalcol , F Rabanal , MD Ludevid - The Journal of , 1995 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/jo00128a033 Structural studies of reagents for peptide bond formation: Crystal and molecular structures of HBTU and HATU I Abdelmoty, F Albericio , LA Carpino - Letters in Peptide , 1994 - Springerhttps://link.springer.com/article/10.1007/BF00126274 Assessment of new 6-Cl-HOBt based coupling reagents for peptide synthesis. Part 1: Coupling efficiency study G Sabatino , B Mulinacci, MC Alcaro, M Chelli - Letters in Peptide , 2002 - Springerhttps://link.springer.com/article/10.1023/A:1024140900571 Designing cell-permeable macrocyclic peptides G Appiah Kubi , PG Dougherty, D Pei - Cyclic Peptide Design, 2019 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-9504-2_3 Design and synthesis of novel hybrid benzamide-peptide histone deacetylase inhibitors F Hu, CJ Chou , JM Gottesfeld - Bioorganic & medicinal chemistry letters, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0960894X09003758 Use of Onium Salt-Based Coupling Reagents in Peptide Synthesis1 F Albericio , JM Bofill, A El-Faham - The Journal of organic , 1998 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jo980807y Developments in peptide and amide synthesis F Albericio - Current opinion in chemical biology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1367593104000444 Automated solid-phase synthesis of cyclic peptides bearing a side-chain tail designed for subsequent chemical grafting D Delforge, M Art, B Gillon, M Dieu, E Delaive - Analytical , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269796904510 Synthesis of Peptides and Small Molecules for the Imaging of Cancer and Disease D Breadner - 2008 - ir.lib.uwo.cahttps://ir.lib.uwo.ca/digitizedtheses/4591/ Preptin analogues: chemical synthesis, secondary structure and biological studies CM Buchanan , Z Peng, A Cefre - Chemical Biology & , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/cbdd.12168 Fast conventional Fmoc solid-phase peptide synthesis with HCTU CA Hood, G Fuentes, H Patel, K Page - European Peptide , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.921 Fast conventional Fmoc solid-phase peptide synthesis: a comparative study of different activators CA Chantell, MA Onaiyekan - Journal of Peptide , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.1419 Phenylglycine racemization in Fmoc-based solid-phase peptide synthesis: Stereochemical stability is achieved by choice of reaction conditions C Liang, MAM Behnam , TR Sundermann, CD Klein - Tetrahedron letters, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0040403917304872 A Dde resin based strategy for inverse solid-phase synthesis of amino terminated peptides, peptide mimetics and protected peptide intermediates A Rai , WG Gutheil - Publication of the European Peptide , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.594 Effect of residual water and microwave heating on the half-life of the reagents and reactive intermediates in peptide synthesis A Pernille Tofteng, SL Pedersen - A European Journal, 2012 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/chem.201200711 alpha/beta-Chimera peptide synthesis with cyclic beta-sugar amino acids: the efficient coupling protocol A Nagy, V Goldschmidt Gőz , I Pinter, V Farkas - Amino acids, 2019 - Springerhttps://link.springer.com/article/10.1007/s00726-019-02702-9 An improved procedure for N-to C-directed (Inverse) solid-phase peptide synthesis A Johansson, E aca
kerblom, K Ersmark - Journal of , 2000 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/cc000022h Evaluation of combined use of O xyma and HATU in aggregating peptide sequences A Caporale, N Doti , A Sandomenico - Journal of Peptide , 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.2977 Synthesis of linear and cyclic opioid-based peptide analogs containing multiple N-methylated amino acid residues A Adamska, B Kolesińska, A Kluczyk - Journal of Peptide , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.2804

Affinity purified Rabbit polyclonal AQP5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF517 antibody, catalog no. 70R-9029

KPNA1 antibody was raised in Rabbit using Human KPNA1 as the immunogen

TTC19 antibody was raised in rabbit using the C terminal of TTC19 as the immunogen

Botulinum Neurotoxin antibody is a monoclonal antibody that detects binds the light chain of botulinum toxin serotype A (BoNT/A). Botulinum neurotoxins (BoNTs), are a family of potent protein toxins produced by anaerobic gram-positive Clostridia. BoNTs are classified as seven different serotypes from BoNT/A to G. The neurospecificity of both BoNTs and tetanus neurotoxin (TeNT) is a key factor contributing to their extraordinary toxicity. This specificity arises from their dual binding involving both gangliosides and protein receptors (Dong et al, 2019; Masuyer et al, 2021.) Once inside neuronal cells, BoNT/A cleaves SNARE proteins and inhibits neurotransmitter release. Infection with the native clostridium or exposure to the toxin results in botulism, including foodborne and wound botulism. See our blog on BoNT and TeNT toxins and their interactions: Toxins and Gangliosides: A Complex Interaction | Blog | Cymit Quimica

Streptococcus group A antibody (HRP) was raised in goat using group A streptococci as the immunogen.

Please enquire for more information about Pomalidomide 4'-alkylc8-acid including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal COX6A1 antibody

Rabbit anti-mouse IgG2b (biotin) was raised in rabbit using murine IgG2b heavy chain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACADVL antibody, catalog no. 70R-9269

A synthetic peptide for use as a blocking control in assays to test for specificity of PSPH antibody, catalog no. 70R-4329

Inhibitor of BRPF2 and TAF1 bromodomains

Please enquire for more information about Defluoro prasugrel-d5 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

Bis-dPEG®5-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®5-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

Please enquire for more information about CKS-17 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Acetyl b-methylthiocholine iodide

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Mouse monoclonal C21orf59 antibody