Biochemicals and Reagents

Inhibitor of beta-lactamase enzymes

Goat anti-dog IgG (H + L) (HRP) was raised in goat using canine IgG, whole molecule as the immunogen.

Goat anti-rabbit IgG (H+L) (Fab'2) (Rhodamine) was raised in goat using rabbit IgG whole molecule as the immunogen.

SLC22A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR

Rabbit Polyclonal JAK2 antibody

Portion of HCMV

Purified Pig IgG FITC conjugate

Retinoid X receptor (RXR) agonist

CP-105,696 is a monoclonal antibody that binds to the chemoattractant protein (CXCL12) and blocks its activity. CP-105,696 has been shown to inhibit the growth of cancer cells in vitro and in vivo by binding to CXCR4, a receptor for CXCL12. It is also used for the treatment of inflammatory bowel disease and other autoimmune diseases. CP-105,696 inhibits inflammatory responses by blocking the release of proinflammatory cytokines IL-1β and TNFα from activated macrophages. The drug binds to a region on the chemokine that is involved in cell signaling, preventing it from interacting with its receptor. CP-105,696 also inhibits angiogenesis by inhibiting vascular endothelial growth factor (VEGF).

Purified Bovine IgG (Fab) FITC conjugate

Please enquire for more information about Itacitinib including the price, delivery time and more detailed product information at the technical inquiry form on this page

Procalcitonin protein is a biomolecule that plays a crucial role in the body's immune response. It is a glycoprotein that is produced in response to bacterial infections and can be used as a diagnostic marker for sepsis. Procalcitonin protein has neutralizing properties and can be targeted by monoclonal antibodies, which are produced by hybridoma cell lines. These monoclonal antibodies specifically bind to procalcitonin protein and can be used for various applications in the field of Life Sciences. Additionally, procalcitonin protein has been found to interact with other molecules such as fibrinogen and chemokines, further highlighting its importance in immune responses. With its potential therapeutic applications, procalcitonin protein holds promise as a target for the development of new medicaments, including DNA vaccines.

PDEs are a family of phosphohydrolyases, used to catalyse hydrolysis of 3 €™ cyclic phosphate bonds in the second messengers adenosine and guanine 3 €™, 5 €™ cyclic monophosphates (cAMP and cGMP). Physiologically, Pde2a is a locus for communication between cAMP and cGMP signalling pathways, regulating this process through degradation of cAMP and cGMP. This is particularly noteworthy in cells where cAMP and cGMP regulate opposing cell functions.Pde2a is expressed both in the periphery and central nervous system, but is found in highest concentration in the brain; implying that Pde2a is necessary in regulation of interneuronal cAMP and cGMP involved in emotion, sensory perception and memory. Alteration in cyclic nucleotide signalling is shown cause depression, bipolar disorder and schizophrenia; hence Pde2a, a molecule used to break down cyclic nucleotides, has the potential to be a novel biomarker or therapeutic target for such psychiatric conditions.

Beta Amyloid peptides, also called Amyloid beta peptides (Abeta peptides) are the main component of amyloid peptide plaques in the brain of patients with Alzheimer's disease. sb-PEPTIDE provides a broad range of chemically synthesized amyloid beta peptides for Alzheimer's disease research. We supply Abeta peptides of different lengths and point-mutated versions. Do not hesitate to contact us for any information.

Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Tauro-β-muricholic acid sodium is a bile acid derivative, which is naturally sourced from mammalian bile. It plays a crucial role in the regulation of bile acid metabolism by modulating the activity of nuclear receptors in the liver and intestine. This compound acts by inhibiting farnesoid X receptor (FXR) signaling, a nuclear receptor that regulates bile acid synthesis, lipid metabolism, and glucose homeostasis. By influencing these pathways, Tauro-β-muricholic acid sodium is an important tool for scientists studying liver function, cholesterol metabolism, and intestinal microbiome interactions. In research applications, this compound is utilized to investigate the modulation of gut microbiota and its impact on metabolic diseases. It serves as a key reagent in the study of bile acid profiles and their physiological effects. By understanding its interactions with cellular receptors, researchers can explore therapeutic avenues for disorders such as non-alcoholic fatty liver disease and cholesterol-related conditions. Tauro-β-muricholic acid sodium thus provides significant insights into the complex interactions between bile acids and metabolic health.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Purified native Human hCG protein

A synthetic peptide for use as a blocking control in assays to test for specificity of ABHD5 antibody, catalog no. 70R-3842

D-(-)-Amethopterin hydrate is an analog of methotrexate, a chemotherapy drug used to treat cancer. It is a potent inhibitor of dihydrofolate reductase, an enzyme involved in the synthesis of DNA, RNA and proteins. D-(-)-Amethopterin hydrate has been shown to induce apoptosis in cancer cells by inhibiting the activity of kinases that regulate cell growth and survival. This drug has also demonstrated anti-tumor activity in human cancer cell lines and Chinese hamster ovary cells. Additionally, D-(-)-Amethopterin hydrate has been found to enhance the activity of rifampicin, an antibiotic used to treat tuberculosis. Its potential as a therapeutic agent for cancer treatment makes it a promising candidate for further research and development.

Influenza A antibody (Matrix) (FITC) was raised in goat using influenza A, Phillipines (H3N2) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF154 antibody, catalog no. 70R-8772

CEA protein is a medicament that has various characteristics and applications in the field of Life Sciences. It is known for its ability to generate autoantibodies, which can be useful in diagnostic tests for certain diseases. Additionally, CEA protein has been found to inhibit the growth of certain cancer cells and exhibit cytotoxic effects. It also plays a role in binding proteins and has antiviral properties. In research settings, CEA protein is commonly used to study endothelial growth and activation. Monoclonal antibodies targeting CEA protein have been developed for therapeutic purposes, such as targeted cancer therapy. These antibodies can specifically bind to CEA-expressing cells and induce cell death. CEA protein is an important component in Native Proteins & Antigens research, as it can be used as a control or standard in immunoassays. It has also been studied for its potential role in hemolysis and its interaction with epidermal growth factor. Overall, CEA protein is

Mouse monoclonal TBXAS1 antibody

The C-peptide antibody is a monoclonal antibody that specifically targets the C-peptide protein in human serum. This antibody has been extensively studied for its potential role in cellular protein synthesis and as an inhibitor of certain reactions. In laboratory settings, the C-peptide antibody has demonstrated cytotoxic effects on cells expressing high levels of the target protein. Additionally, this antibody has been used to investigate calcium binding and mineralization processes in various experimental models, including liver microsomes. The C-peptide antibody can be a valuable tool for researchers studying autoantibodies or histidine-related biological processes. Its high specificity and affinity make it an excellent choice for applications requiring precise detection and quantification of the C-peptide protein.

A synthetic peptide for use as a blocking control in assays to test for specificity of PDS5A antibody, catalog no. 70R-3908

Mouse monoclonal CD235a antibody (biotin)

Purified Rabbit polyclonal GLX1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CAMKK2 antibody, catalog no. 70R-5776

Lignan P is a phytoestrogen product composed of plant-derived lignans, primarily sourced from flaxseeds and other lignan-rich seeds. These compounds are classified under a group of polyphenolic substances found in high concentrations within the seeds and are notable for their antioxidant properties. The mode of action of Lignan P involves its conversion into enterolignans by gut microbiota, which can mimic the function of human estrogens by binding to estrogen receptors, thereby influencing estrogenic activity within the body. This ability to interact with estrogen pathways makes Lignan P a potential candidate for modulating hormone-related processes. In scientific research, Lignan P is utilized to investigate its role in various health applications, such as cardiovascular health, osteoporosis, and hormone-dependent cancers. Its antioxidant content further broadens its use in studying oxidative stress-related conditions. Researchers focus on its potential in developing novel therapies targeting metabolic and endocrine disorders. Lignan P provides an avenue for exploring the intersection of nutrition, plant chemistry, and human physiology.

Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page

BRPF1 antibody was raised in mouse using recombinant Human Bromodomain And Phd Finger Containing, 1 (Brpf1)

The beta hCG antibody is a monoclonal antibody that specifically targets the beta subunit of human chorionic gonadotropin (hCG). It plays a crucial role in various biological processes, including embryonic development, pregnancy maintenance, and tumor growth. The beta hCG antibody has been extensively studied for its antiviral properties, as it can neutralize viral particles by blocking their entry into host cells. Additionally, this antibody has been shown to modulate chemokine signaling pathways and inhibit the activity of serine proteases involved in inflammation. It also acts as a family kinase inhibitor, preventing the activation of certain signaling cascades associated with cell proliferation and survival. In terms of applications, the beta hCG antibody is widely used in research laboratories for immunohistochemistry, flow cytometry, and Western blotting experiments. Its high specificity and affinity make it an ideal tool for detecting and quantifying beta hCG levels in biological samples. Furthermore, this antibody can be utilized in diagnostic

Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PAFSAIR^-OH include the following: De novo sequencing assisted approach for characterizing mixture MS/MS spectra Y Liu , W Sun , J John , G Lajoie , B Ma - IEEE Transactions on , 2016 - ieeexplore.ieee.orghttps://ieeexplore.ieee.org/abstract/document/7386660/

Purified recombinant Human S100A11 protein

Purified recombinant NBL1 protein (His tag)

Recombinant Human Creatine Kinase MB Isoenzyme Type-2

Please enquire for more information about 3,4-Diaminotoluene-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-KTEEISEVNL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KTEEISEVNL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KTEEISEVNL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KTEEISEVNL-OH at the technical inquiry form on this page

Highly purified Mouse IgG (H + L) for use as a control or blocking reagent