Biochemicals and Reagents

Bilirubin

Peptide H-GLSPNLNRFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLSPNLNRFL-OH include the following: Detection, isolation, and characterization of alpha-fetoprotein-specific T cell populations and clones using MHC class I multimer magnetic sorting V Pichard, PJ Royer, C Richou, E Cauchin - Journal of , 2008 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2008/04000/Detection,_Isolation,_and_Characterization_of.3.aspx Alpha-fetoprotein is an autoantigen in hepatocellular carcinoma and juvenile Batten R Bei , GJ Mizejewski - researchgate.nethttps://www.researchgate.net/profile/Gerald-Mizejewski/publication/337335379_912_Alpha-fetoprotein_is_an_autoantigen_in_hepatocellular_carcinoma_and_juvenile_Batten_disease/links/5dd31fc9a6fdcc7e138d2990/912-Alpha-fetoprotein-is-an-autoantigen-in-hepatocellular-carcinoma-and-juvenile-Batten-disease.pdf Alpha-fetoprotein is an autoantigen in hepatocellular carcinoma and juvenile Batten disease R Bei , GJ Mizejewski - Frontiers in Bioscience-Landmark, 2020 - imrpress.comhttps://www.imrpress.com/journal/FBL/25/5/10.2741/4840/htm Alpha fetoprotein is more than a hepatocellular cancer biomarker: from spontaneous immune response in cancer patients to the development of an AFP-based cancer R Bei , GJ Mizejewski - Current Molecular Medicine, 2011 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cmm/2011/00000011/00000007/art00004 Detailed analysis of immunologic effects of the cytotoxic T lymphocyte-associated antigen 4-blocking monoclonal antibody tremelimumab in peripheral blood of B Comin-Anduix, Y Lee, J Jalil, A Algazi - Journal of translational , 2008 - Springerhttps://link.springer.com/article/10.1186/1479-5876-6-22

p0071 antibody was raised in Guinea Pig using a synthetic peptide cocktail of human p0071 as the immunogen.

H-LRDFILIAARTVELL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LRDFILIAARTVELL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LRDFILIAARTVELL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LRDFILIAARTVELL-OH at the technical inquiry form on this page

This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.

A synthetic peptide for use as a blocking control in assays to test for specificity of MPDZ antibody, catalog no. 70R-2266

Recombinant human RAB32 protein (His tag)

ATP2A2 antibody was raised using the C terminal of ATP2A2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV

Sheep polyclonal Halofuginone antibody

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

GLN-1062 is a prodrug, crafted to facilitate the enhanced delivery of glutathione precursors across the blood-brain barrier. It is sourced from the modification of existing compounds to improve central nervous system (CNS) penetration. The mode of action involves enzymatic conversion within the CNS, releasing active ingredients that support glutathione synthesis. This mechanism is particularly important for neuroprotection and the mitigation of oxidative stress, as glutathione plays a critical role in cellular defense and detoxification processes. Applications of GLN-1062 are primarily in the field of neurological research, with a focus on conditions where oxidative stress is a contributing factor, such as neurodegenerative diseases. Scientists explore its potential benefits in combating cellular damage and promoting neural health, leveraging its effective delivery mechanism to target CNS tissues.

Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GGSC-OH include the following: Biophysical and biochemical characterization of avian secretory component provides structural insights into the evolution of the polymeric Ig receptor BM Stadtmueller , Z Yang , KE Huey-Tubman - The Journal of ..., 2016 - journals.aai.orghttps://journals.aai.org/jimmunol/article/197/4/1408/105846 Selection of an optimal cysteine-containing peptide-based chelator for labeling of affibody molecules with 188Re M Altai , H Honarvar , H Wållberg, J Strand- European Journal of ..., 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523414009015 Order of amino acids in C-terminal cysteine-containing peptide-based chelators influences cellular processing and biodistribution of 99mTc-labeled recombinant M Altai , H Wållberg, A Orlova , M Rosestedt- Amino acids, 2012 - Springerhttps://link.springer.com/article/10.1007/s00726-011-0927-x

5(S),12(S)-Dihete is a potent inhibitor with potential anticancer properties. It has been extensively studied for its ability to induce apoptosis in cancer cells by inhibiting kinases that are essential for tumor cell growth and survival. This inhibitor has shown promising results in Chinese hamster ovary cells, human leukemia cells, and other cancer cell lines. Additionally, 5(S),12(S)-Dihete has been found in urine samples of patients undergoing chemotherapy, indicating its potential as a medicinal agent in cancer treatment. Its mechanism of action involves disrupting the cell cycle and interfering with protein synthesis, leading to the inhibition of cancer cell growth and proliferation. Overall, 5(S),12(S)-Dihete shows great promise as a potential anticancer agent and warrants further investigation.

NPY (Human, Rat) is a peptide that belongs to the family of neuropeptides. It is a central neurotransmitter and neuromodulator in the brain and has an important role in the regulation of many physiological processes, including feeding behavior, body weight, blood pressure, stress responses and reproduction. NPY (Human, Rat) is used as a research tool for studying ion channels and receptor interactions. This product is also used to develop antibodies that can be used as a research tool or diagnostic reagent. NPY (Human, Rat) is not active when taken orally; it must be injected into the body.

Human sequence expressed in E. coli Cells; purity >90% by SDS-PAGE and HPLC.

GIOT-1 antibody was raised in rabbit using the N terminal of GIOT-1 as the immunogen