Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies
- Cardiovascular Antibodies
- Cell Biology Antibodies
- Developmental Biology
- Epigenetics Antibodies
- Immunology Antibodies
- Metabolism Antibodies
- Microbiology Antibodies
- Neuroscience Antibodies
- Signal Transduction
- Stem Cell Antibodies
- Tags & Cellular Markers
Show 4 more subcategories
Products of "Primary Antibodies"
Sort by
PCBP2 antibody
PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEAnti-PPY Monoclonal Antibody-AF555
Anti-PPY Monoclonal Antibody-AF555 is a Biotin-conjugated rabbit antibody targeting PPY. Anti-PPY Monoclonal Antibody-AF555 can be used in FACS.Purity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDaCollagen Type IV antibody
Collagen type IV antibody was raised in mouse using human placental type IV collagen as the immunogen.IL-2Rβ (phospho Tyr364) rabbit pAb
The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. The use of alternative promoters results in multiple transcript variants encoding the same protein. The protein is primarily expressed in the hematopoietic system. The use by some variants of an alternate promoter in an upJund antibody
Jund antibody was raised in rabbit using the N terminal of Jund as the immunogenPurity:Min. 95%A Cyclase VIII rabbit pAb
Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase [provided by RefSeq, Jul 2008],GNAO1 antibody
GNAO1 antibody was raised using the middle region of Gnao1 corresponding to a region with amino acids CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLPurity:Min. 95%Goat anti Monkey IgG + IgA + IgM (H + L) (Texas Red)
Goat anti-monkey IgG/IgA/IgM (H+L) was raised in goat using Monkey IgG, IgA and IgM whole molecules as the immunogen.Purity:Min. 95%Anti-RBP3 Monoclonal Antibody-APC
Anti-RBP3 Monoclonal Antibody-APC is a Biotin-conjugated rabbit antibody targeting RBP3. Anti-RBP3 Monoclonal Antibody-APC can be used in FACS.Purity:> 95% as determined by SDS-PAGE.Color and Shape:LiquidMolecular weight:150 kDa
