Peptides

A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD42 antibody, catalog no. 70R-4932

A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf75 antibody, catalog no. 70R-3687

Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DPTFIPAPIQAK^-OH include the following: An integrated quantitative proteomics workflow for cancer biomarker discovery and validation in plasma V Kumar , S Ray , S Ghantasala , S Srivastava - Frontiers in oncology, 2020 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2020.543997/full ASMS 2017 WP 055 S Mukherjee , S Walunj , P Sutar, A Datar, A Moiyadi - shimadzu.co.krhttps://www.shimadzu.co.kr/sites/shimadzu.co.kr/files/pim/pim_document_file/technical/white_papers/11486/apo21766.pdf Quantification of urinary protein biomarkers of autosomal dominant polycystic kidney disease by parallel reaction monitoring N Rauniyar , X Yu , J Cantley, EZ Voss - PROTEOMICS , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201700157 A proteomic approach identifies candidate early biomarkers to predict severe dengue in children DM Nhi , NT Huy , K Ohyama, D Kimura - PLoS neglected , 2016 - journals.plos.orghttps://journals.plos.org/plosntds/article?id=10.1371/journal.pntd.0004435

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of CD28 antibody, catalog no. 70R-9669

Peptide H-DPLSMVGPTQGRSPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DPLSMVGPTQGRSPSYAS-OH include the following: Targeting an acid labile aspartyl-prolyl amide bond as a viable alternative to trypsin digestion to generate a surrogate peptide for LC-MS/MS analysis EN Fung, F Zambito, J Haulenbeek, SP Piccoli - Bioanalysis, 2014 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.14.182

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of FGFR2 antibody, catalog no. 70R-9972

Custom research peptide; min purity 95%.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.

Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.

Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin.

Peptide H-EAEDLQVGQVELGGGPGAGSLQPLALEGSL^Q-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EIPVESIEEVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EIPVESIEEVSK-OH include the following: The diabetogenic antibiotic streptozotocin modifies the tryptic digest pattern for peptides of the enzyme O-GlcNAc-selective N-acetyl-β-D-glucosaminidase that contain TN Lee, WE Alborn, MD Knierman , RJ Konrad - Biochemical pharmacology, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006295206003510

Peptide H-SPRWYFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SPRWYFYYL-OH include the following: Epitope-anchored contrastive transfer learning for paired CD8+ T cell receptor-antigen recognition Y Zhang, Z Wang , Y Jiang , DR Littler , M Gerstein - bioRxiv, 2024 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2024.04.05.588255.abstract Reverse vaccinology-based prediction of a multi-epitope SARS-CoV-2 vaccine and its tailoring to new coronavirus variants W Ezzemani, A Kettani , S Sappati - Journal of , 2023 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2022.2075468 Magnitude and dynamics of the T-cell response to SARS-CoV-2 infection at both individual and population levels TM Snyder , RM Gittelman, M Klinger, DH May - MedRxiv, 2020 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC7418734/ CD8+ T cells specific for an immunodominant SARS-CoV-2 nucleocapsid epitope display high naive precursor frequency and TCR promiscuity THO Nguyen , LC Rowntree , J Petersen , BY Chua - Immunity, 2021 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(21)00171-0.pdf High Precursor Frequency and Promiscuity in Αbeta T Cell Receptor Pairing Underpin CD8+ T-Cell Responses to an Immunodominant SARS-CoV-2 Nucleocapsid THO Nguyen , LC Rowntree , J Petersen , B Chua - 2021 - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=3751796 SARS-CoV-2 genome-wide T cell epitope mapping reveals immunodominance and substantial CD8+ T cell activation in COVID-19 patients SK Saini , DS Hersby, T Tamhane, HR Povlsen - Science , 2021 - science.orghttps://www.science.org/doi/abs/10.1126/sciimmunol.abf7550 Profiling SARS-CoV-2 HLA-I peptidome reveals T cell epitopes from out-of-frame ORFs S Weingarten-Gabbay , S Klaeger , S Sarkizova - Cell, 2021 - cell.comhttps://www.cell.com/cell/pdf/S0092-8674(21)00701-7.pdf Limited recognition of highly conserved regions of SARS-CoV-2 S Swaminathan , KE Lineburg - Microbiology , 2022 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/spectrum.02780-21 Prevalent and immunodominant CD8 T cell epitopes are conserved in SARS-CoV-2 variants S Meyer, I Blaas, RC Bollineni , M Delic-Sarac, TT Tran - Cell reports, 2023 - cell.comhttps://www.cell.com/cell-reports/pdf/S2211-1247(23)00006-2.pdf TCRmodel2: high-resolution modeling of T cell receptor recognition using deep learning R Yin , HV Ribeiro-Filho , V Lin - Nucleic Acids , 2023 - academic.oup.comhttps://academic.oup.com/nar/article-abstract/51/W1/W569/7151345 Prediction of epitope based peptides for vaccine development from complete proteome of novel corona virus (SARS-COV-2) using immunoinformatics R Jain , A Jain , SK Verma - International Journal of Peptide Research and , 2021 - Springerhttps://link.springer.com/article/10.1007/s10989-021-10205-z Computational perspectives revealed prospective vaccine candidates from five structural proteins of novel SARS corona virus 2019 (SARS-CoV-2) R Anand , S Biswal, R Bhatt, BN Tiwary - PeerJ, 2020 - peerj.comhttps://peerj.com/articles/9855/ Sars-arena: Sequence and structure-guided selection of conserved peptides from sars-related coronaviruses for novel vaccine development MM Rigo , R Fasoulis , A Conev , S Hall-Swan - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2022.931155 SARS-CoV-2-seronegative subjects target CTL epitopes in the SARS-CoV-2 nucleoprotein cross-reactive to common cold coronaviruses KG Schmidt, K Nganou-Makamdop - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2021.627568/full Most Japanese individuals are genetically predisposed to recognize an immunogenic protein fragment shared between COVID-19 and common cold JM Dijkstra , AP Frenette, B Dixon - F1000Research, 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8108557/ Development of a multi-antigenic SARS-CoV-2 vaccine candidate using a synthetic poxvirus platform F Chiuppesi, MA Salazar, H Contreras - Nature , 2020 - nature.comhttps://www.nature.com/articles/s41467-020-19819-1 A common allele of HLA is associated with asymptomatic SARS-CoV-2 infection DG Augusto , LD Murdolo, DSM Chatzileontiadou - Nature, 2023 - nature.comhttps://www.nature.com/articles/s41586-023-06331-x STAPLER: efficient learning of TCR-peptide specificity prediction from full-length TCR-peptide data BPY Kwee, M Messemaker , E Marcus , G Oliveira - bioRxiv, 2023 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2023.04.25.538237.abstract Inferring MHC interacting SARS-CoV-2 epitopes recognized by TCRs towards designing T cell-based vaccines AH Mohseni , S Taghinezhad-S , B Su, F Wang - bioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.09.12.294413.abstract De novo design of anti-variant COVID vaccine with T-cell memory A Goswami, SM Kumar, MM Gore - concern, 2022 - researchgate.nethttps://www.researchgate.net/profile/Arpita-Goswami-2/publication/364600570_De_novo_design_of_anti-variant_COVID_vaccine_with_T-cell_memory/links/63bd535d097c7832caa6a98a/De-novo-design-of-anti-variant-COVID-vaccine-with-T-cell-memory.pdf

Peptide Ac-LKISQAPQVSISRSKSYRENGAPFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-LKISQAPQVSISRSKSYRENGAPFC-NH2 include the following: Mutation of ARX causes abnormal development of forebrain and testes in mice and X-linked lissencephaly with abnormal genitalia in humans K Kitamura, M Yanazawa, N Sugiyama, H Miura - Nature , 2002 - nature.comhttps://www.nature.com/articles/ng1009z

A synthetic peptide for use as a blocking control in assays to test for specificity of SMPD2 antibody, catalog no. 70R-6846

A synthetic peptide for use as a blocking control in assays to test for specificity of SYDE1 antibody, catalog no. 70R-3763

Peptide H-QWHEDITQDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QWHEDITQDLR-OH include the following: The pathogenic Escherichia coli type III secreted protease NleC degrades the host acetyltransferase p300 SR Shames , AP Bhavsar , MA Croxen - Cellular , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1462-5822.2011.01640.x

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB2A antibody, catalog no. 70R-10318

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-FSPIRITFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FSPIRITFL-OH include the following: Nucleoprotein vaccine induces cross-protective cytotoxic T lymphocytes against both lineages of influenza B virus SY Lee, JO Kang, J Chang - Clinical and Experimental Vaccine , 2019 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6369129/ Single mucosal vaccination targeting nucleoprotein provides broad protection against two lineages of influenza B virus MH Kim, JO Kang, JY Kim, HE Jung , HK Lee , J Chang - Antiviral Research, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166354218305898 The role of nucleoprotein in immunity to human negative-stranded RNA viruses-not just another brick in the viral nucleocapsid M Å antak , Z Matic - Viruses, 2022 - mdpi.comhttps://www.mdpi.com/1999-4915/14/3/521 A"prime and deploy" strategy for universal influenza vaccine targeting nucleoprotein induces lung-resident memory CD8 T cells H Chung, EA Kim, J Chang - Immune Network, 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8410988/

A synthetic peptide for use as a blocking control in assays to test for specificity of GPR174 antibody, catalog no. 70R-10017

Peptide H-WIILGLNKIVRMYSPTSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WIILGLNKIVRMYSPTSI-OH include the following: Maturation of human dendritic cells with Saccharomyces cerevisiae (yeast) reduces the number and function of regulatory T cells and enhances the ratio of antigen V Cereda, M Vergati, NY Huen, MG di Bari, C Jochems - Vaccine, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X11006566 In vitro priming recapitulates in vivo HIV-1 specific T cell responses, revealing rapid loss of virus reactive CD4+ T cells in acute HIV-1 infection RL Sabado, DG Kavanagh, DE Kaufmann , K Fru - PLoS One, 2009 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC2626278/ HIV-DC interactions: Implications for T cell activation and vaccine design RL Sabado - 2009 - search.proquest.comhttps://search.proquest.com/openview/2ee2b8e6a883cf7beb6ec8566062a70b/1?pq-origsite=gscholar&cbl=18750 In Vitro Priming Recapitulates In Vivo HIV-1 Specific T Cell Responses, Revealing Rapid Loss of Virus Reactive CD4+ T Cells in Acute HIV-1 Infection R Lubong Sabado, DG Kavanagh, DE Kaufmann - PloS one, 2009 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0004256 In Vitro Priming Recapitulates In Vivo HIV-1 Specific T Cell Responses R Lubong Sabado, DG Kavanagh, DE Kaufmann , K Fru - 2009 - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/12b0/906afdf5600f5ecdadbd31104632000c97d7.pdf

Ac-DEVD-pNA is the preferred peptidic substrate for caspase-3.

Peptide LCBiot-ELSEALGQIFDSQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-ELSEALGQIFDSQR-OH include the following: Antibody-mediated blockade for galectin-3 binding protein in tumor secretome abrogates PDAC metastasis YS Choi, MJ Kim, EA Choi, S Kim - Proceedings of the , 2022 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.2119048119 Integration of 18O Labeling and Solution Isoelectric Focusing in a Shotgun Analysis of Mitochondrial Proteins J Wang, P Gutierrez, N Edwards - Journal of proteome , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr070401e Integration of oxygen-18 labeling and solution isoelectric focusing in a shotgun analysis of mitochondrial proteins J Wang - 2007 - search.proquest.comhttps://search.proquest.com/openview/e2e834beab184ff2bda1a6bed0fb04d8/1?pq-origsite=gscholar&cbl=18750

Peptide H-GSGFFVFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GSGFFVFSR-OH include the following: Combination of magnetic beads extraction and ultraperformance liquid chromatography tandem mass spectrometry detection for the clinical diagnosis of allergies Y Li, Y Yang , Y Liu, J Liu, Y Yang, J Zhang, Y Zou - Analytica Chimica , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267022007280

GDNF is a growth factor that was originally identified in the rat brain as a trophic factor for dopaminergic neurons. It has been found to be involved in the regulation of mood and to have acute-phase effects in animals. GDNF is also an antigen that stimulates antibody production and is used as a diagnostic marker for certain diseases. GDNF is a neurotrophic factor that affects neural progenitor cells, promoting their survival and differentiation into neurons. It has been found to have neurotrophic effects on striatal dopaminergic neurons, which may be responsible for its antidepressant effect. GDNF is a member of the family of neurotrophins, which includes nerve growth factor (NGF) and brain-derived neurotrophic factor (BDNF). The gene encoding GDNF contains two exons separated by an intron and encodes a protein with 209 amino acids.

Peptide H-DGGAWGTEQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DGGAWGTEQR-OH include the following: Identification of glia maturation factor beta as an independent prognostic predictor for serous ovarian cancer YL Li, F Ye , XD Cheng, Y Hu, CY Zhou, WG Lue - European journal of , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0959804910003370 From carbohydrate to peptidomimetic inhibitors of galectins KH Mayo - Galectins and Disease Implications for Targeted , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bk-2012-1115.ch003

A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA8L2 antibody, catalog no. 70R-6045

A synthetic peptide for use as a blocking control in assays to test for specificity of RPL23A antibody, catalog no. 70R-10400

His-Pro hydrochloride is a dipeptide consisting of histidyl and proline.

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4G2 antibody, catalog no. 70R-4902

A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5814

Catalogue peptide; min. 95% purity

Ac-Asp-Gln-Thr-Asp-AMC is a synthetic peptide that is used as a research tool for the study of protein interactions and protein function. It can be used to inhibit the activity of ion channels, such as potassium channels, and to activate cell surface receptors. Ac-Asp-Gln-Thr-Asp-AMC has an amino acid sequence that resembles peptides found in naturally occurring proteins. Ac-Asp-Gln-Thr-Asp-AMC also has a molecular weight of 333.6 daltons and a CAS number of 125094-99-0.

FGF-9 is a peptide that belongs to the FGF family. It is also known as heparin-binding growth factor, and has been shown to stimulate cell proliferation, angiogenesis, and bone formation. FGF-9 has been shown to activate EGFR and ERBB2 (HER2) receptor tyrosine kinases. In addition, it has been demonstrated to inhibit chloride channels such as CFTR and K+ channels. FGF-9 is a potent inhibitor of protein interactions with the extracellular matrix (ECM). This inhibition may be due to its ability to bind ECM proteins such as fibronectin and vitronectin. FGF-9 is purified by a high performance liquid chromatography process that yields a product with >98% purity.br>br> CAS No: 97766-81-3 br>br> Receptor: EGFR Ligand: Fibronect

Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Peptide H-LLAQTTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLAQTTLR-OH include the following: Photoaffinity labeling of mefloquine-binding proteins in human serum, uninfected erythrocytes and Plasmodium falciparum-infected erythrocytes J Desneves, G Thorn, A Berman, D Galatis - Molecular and , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0166685196027326 Human erythrocyte band 7.2 b is preferentially labeled by a photoreactive phospholipid J Desneves, A Berman, K Dynon, N La Greca - Biochemical and , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X96909924

A synthetic peptide for use as a blocking control in assays to test for specificity of PFDN2 antibody, catalog no. 70R-9434

Peptide H-TDTGVSLQTYDDLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TDTGVSLQTYDDLLAK^-OH include the following: Proteome and secretome analysis of pancreatic cancer cells X Li , H Liu, MD Dun , S Faulkner, X Liu, CC Jiang - , 2022 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.202100320 Protection of beta cells against pro-inflammatory cytokine stress by the GDF15-ERBB2 signaling S Sarkar , F Syed , BJ Webb-Robertson , JT Melchior - medRxiv, 2023 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2023.11.27.23298904.abstract

Peptide H-GAYPLSIEPIGV^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GAYPLSIEPIGV^R-OH include the following: Cross-platform Clinical Proteomics using the Charite Open Standard for Plasma Proteomics (OSPP) Z Wang , V Farztdinov, LR Sinn, P Tober-Lau, D Ludwig - medRxiv, 2024 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2024.05.10.24307167.abstract

A synthetic peptide for use as a blocking control in assays to test for specificity of AQP10 antibody, catalog no. 70R-7450

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF170 antibody, catalog no. 70R-6665

Peptide H-LFDSDPITVTVPVEVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LFDSDPITVTVPVEVSR-OH include the following: Towards clinical applications of selected reaction monitoring for plasma protein biomarker studies C Krisp, SA Randall, MJ McKay - PROTEOMICS-Clinical , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201100062 A mass spectrometry-based plasma protein panel targeting the tumor microenvironment in patients with breast cancer A Cohen , E Wang, KA Chisholm, R Kostyleva - Journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391912007440

Peptide YY (PYY) is a peptide hormone that inhibits gastric emptying and increases intestinal transit time. This peptide can be given as an intubation, perfusion, or intravenous infusion to increase the absorption of nutrients. It also has the potential to reduce body weight in obese people. PYY is a potent activator of protein synthesis and it has been shown to stimulate lipolysis in adipocytes. PYY is found in the ileum and colon, where it may have its effects on appetite suppression and regulation of gastrointestinal motility.

G CSF Mouse is a recombinant protein that is an inhibitor of the G-CSF receptor. It has been shown to inhibit the activity of ion channels in cells. G CSF Mouse is a research tool that can be used to study the biology of proteins and peptides. This product can also be used for antibody production and as a reagent for cell biology and pharmacology experiments.

A synthetic peptide for use as a blocking control in assays to test for specificity of PIP3-E antibody, catalog no. 70R-3184

Peptide H-GLQEAAEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLQEAAEER-OH include the following: Predictors of Cognitive Decline in Healthy Middle-Aged Individuals with Asymptomatic Alzheimer's Disease R Tandon , L Zhao, CM Watson , M Elmor - Research , 2023 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC10002814/

Peptide H-IPVIGPLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IPVIGPLK-OH include the following: Targeted host cell protein quantification by LC-MRM enables biologics processing and product characterization X Gao, B Rawal , Y Wang, X Li , D Wylie, YH Liu - Analytical , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.9b03952

Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GALQNIIPASTGAAK^-OH include the following: A comprehensive functional assessment of carboxylesterase 1 nonsynonymous polymorphisms X Wang , N Rida, J Shi, AH Wu, BE Bleske - Drug Metabolism and , 2017 - ASPEThttps://dmd.aspetjournals.org/content/45/11/1149.abstract peptides in HeLa cell cytoplasm by targeted liquid chromatography/mass spectrometry and stable isotope dilution: emphasising the distinction between peptide T Le Bihan , R Grima , S Martin, T Forster - in Mass Spectrometry , 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.4487 Reply to Krupenko et al. Comment on"Lee et al. The Combination of Loss of ALDH1L1 Function and Phenformin Treatment Decreases Tumor Growth in KRAS-Driven SH Lee, Y Jeon, JH Kang, H Jang , KM Hong, D Hong - Cancers, 2021 - mdpi.comhttps://www.mdpi.com/2072-6694/13/9/2238 Multiple reaction monitoring-based targeted assays for the validation of protein biomarkers in brain tumors S Ghantasala , MGJ Pai , D Biswas , N Gahoi - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2021.548243/full Proteomics for cancer biomarker discovery PR Srinivas, M Verma , Y Zhao , S Srivastava - Clinical chemistry, 2002 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/48/8/1160/5642216 Combined Targeted Proteomics and Oxylipin Metabolomics for Monitoring of the COX-2 Pathway NM Hartung, AI Ostermann, S Immenschuh - , 2021 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201900058 A multiplexed assay for quantifying immunomodulatory proteins supports correlative studies in immunotherapy clinical trials JR Whiteaker , L Zhao, RM Schoenherr, D Huang - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2023.1168710/full Aldehyde dehydrogenase inhibition combined with phenformin treatment reversed NSCLC through ATP depletion JH Kang, SH Lee, JS Lee, B Nam, TW Seong, J Son - Oncotarget, 2016 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5226516/ Aldehyde dehydrogenase is used by cancer cells for energy metabolism JH Kang, SH Lee, D Hong , JS Lee, HS Ahn - & molecular medicine, 2016 - nature.comhttps://www.nature.com/articles/emm2016103 Mass spectrometry-based analysis of formalin-fixed, paraffin-embedded distal cholangiocarcinoma identifies stromal thrombospondin-2 as a potential prognostic J Byrling, T Kristl, D Hu , I Pla , A Sanchez - Journal of translational , 2020 - Springerhttps://link.springer.com/article/10.1186/s12967-020-02498-3 Label-free protein profiling of adipose-derived human stem cells under hyperosmotic treatment ES Oswald, LM Brown, JC Bulinski - Journal of proteome , 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr200030v Improved proteome coverage by using iTRAQ labelling and peptide OFFGEL fractionation E Ernoult, E Gamelin, C Guette - Proteome Science, 2008 - Springerhttps://link.springer.com/article/10.1186/1477-5956-6-27 Dengue virus NS1 protein modulates cellular energy metabolism by increasing glyceraldehyde-3-phosphate dehydrogenase activity D Allonso , IS Andrade, JN Conde, DR Coelho - Journal of , 2015 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01342-15 Muscle induction by the tropomyosin 3' untranslated region: Sequence specific binding to glyceraldehyde-3-phosphate dehydrogenase A Rodriguez - 2003 - search.proquest.comhttps://search.proquest.com/openview/98c94d9ef91f73ebc85ce4e99a9d76ac/1?pq-origsite=gscholar&cbl=18750&diss=y

Peptide LCBiot-QRFVTGHFGGLYPANG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-QRFVTGHFGGLYPANG-OH include the following: Engineering antibody Fc domains for improved therapeutic function WJ Kelton - 2013 - repositories.lib.utexas.eduhttps://repositories.lib.utexas.edu/items/0bcb2ea1-7856-41ef-8d89-fb96e9052287 Man-made antibodies and immunoconjugates with desired properties: function optimization using structural engineering SM Deyev, EN Lebedenko - Russian chemical , 2015 - iopscience.iop.orghttps://iopscience.iop.org/article/10.1070/RCR4459/meta Functionalized zein nanoparticles targeting neonatal Fc receptor to enhance lung absorption of peptides F Hameedat , S Pinto, J Marques, S Dias - Drug Delivery and , 2023 - Springerhttps://link.springer.com/article/10.1007/s13346-022-01286-4

Peptide H-DLPLTFGGGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DLPLTFGGGTK^-OH include the following: Multicenter Pharmacokinetic and Pharmacodynamic Study of Pembrolizumab for Non-small-Cell Lung Cancer in Patients Aged 75 Years and Older S Yagishita , Y Yamanaka, T Kurata - Clinical Pharmacology - Wiley Online Libraryhttps://ascpt.onlinelibrary.wiley.com/doi/abs/10.1002/cpt.3339 Analysis of pembrolizumab in human plasma by LC-MS/HRMS. Method validation and comparison with elisa A Millet, N Khoudour, J Guitton, D Lebert, F Goldwasser - Biomedicines, 2021 - mdpi.comhttps://www.mdpi.com/2227-9059/9/6/621

Cyclo(his-pro) is a cyclic dipeptide that shields against oxidative damage by activating Nrf2.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A35 antibody, catalog no. 70R-6514

Peptide H-GLDKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLDKDY-NH2 include the following: A unified peptide array platform for antibody epitope binning, mapping, specificity and predictive off-target binding C Moore, A Lei, P Walsh, O Trenchevska, G Saini - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.06.22.497251.abstract

Peptide H-ITFGGPSDSTGSNQNGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ITFGGPSDSTGSNQNGER^-OH include the following: Osmotic Processor for Enabling Sensitive and Rapid Biomarker Detection via Lateral Flow Assays SY Chen , AY Wu , R Lunde, JJ Lai - Frontiers in Bioengineering and , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fbioe.2022.884271/full Integrated immunopeptidomics and proteomics study reveals imbalanced innate and adaptive immune responses to SARS-CoV-2 infection R Chen , KM Fulton, A Tran, D Duque, K Kovalchik - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.08.23.504798.abstract Variable posttranslational modifications of severe acute respiratory syndrome coronavirus 2 nucleocapsid protein NT Supekar , A Shajahan , AS Gleinich - , 2021 - academic.oup.comhttps://academic.oup.com/glycob/article-abstract/31/9/1080/6275362 SARS-CoV-2 Nucleocapsid protein is decorated with multiple N-and O-glycans NT Supekar , A Shajahan , AS Gleinich, D Rouhani - BioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.08.26.269043.abstract A SISCAPA-based approach for detection of SARS-CoV-2 viral antigens from clinical samples KK Mangalaparthi , S Chavan , AK Madugundu - Clinical Proteomics, 2021 - Springerhttps://link.springer.com/article/10.1186/s12014-021-09331-z

A synthetic peptide for use as a blocking control in assays to test for specificity of GNAQ antibody, catalog no. 70R-5722

A synthetic peptide for use as a blocking control in assays to test for specificity of GARS antibody, catalog no. 70R-2361

Bromoacetamido-dPEG®4-Amido-DBCO is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®4-Amido-DBCO is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

DNP-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DNP-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Peptide H-ESEERPPTPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ESEERPPTPY-OH include the following: Immortalized B cells transfected with mRNA of antigen fused to MITD (IBMAM): an effective tool for antigen-specific T-cell expansion and TCR validation Z Wang , T Zhang , A Anderson, V Lee, S Szymura - Biomedicines, 2023 - mdpi.comhttps://www.mdpi.com/2227-9059/11/3/796 Identification of functional HLA-A* 01: 01-restricted Epstein-Barr latent membrane protein 2-specific T-cell receptors W Huisman, I Gille, LE van der Maarel- The Journal of ..., 2022 - academic.oup.comhttps://academic.oup.com/jid/article-abstract/226/5/833/5893824 Charakterisierung HLA-A* 01-sowie HLA-A* 26-restringierter EBV-Epitope-Implikationen für den Supertyp E Gabriel - 2020 - ub01.uni-tuebingen.dehttps://ub01.uni-tuebingen.de/xmlui/handle/10900/96834 C-terminal domain of the Epstein-Barr virus LMP2A membrane protein contains a clustering signal L Matskova, I Ernberg, T Pawson, G Winberg - Journal of Virology, 2001 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.75.22.10941-10949.2001

A synthetic peptide for use as a blocking control in assays to test for specificity of ADH1B antibody, catalog no. 70R-3920

DBCO-dPEG®4-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DBCO-dPEG®4-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A synthetic peptide for use as a blocking control in assays to test for specificity of C22orf31 antibody, catalog no. 70R-9572

Catalogue peptide; min. 95% purity

Peptide H-ENLQFSAALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ENLQFSAALR-OH include the following: Stable isotope dilution mass spectrometry for membrane transporter quantitation V Farrokhi , AJ McShane, R Nemati , X Yao - The AAPS journal, 2013 - Springerhttps://link.springer.com/article/10.1208/s12248-013-9529-8 Transport-Glucuronidation Classification System and PBPK Modeling: New Approach To Predict the Impact of Transporters on Disposition of Glucuronides S Ge, Y Wei, T Yin, B Xu, S Gao, M Hu - Molecular Pharmaceutics, 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.molpharmaceut.6b00941 Efflux transporter breast cancer resistance protein dominantly expresses on the membrane of red blood cells, hinders partitioning of its substrates into the cells, and P Shi, M Liao, BC Chuang, R Griffin , J Shi, M Hyer - Xenobiotica, 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/00498254.2017.1397812 LC-MS/MS mediated absolute quantification and comparison of bile salt export pump and breast cancer resistance protein in livers and hepatocytes across species N Li, J Palandra, OV Nemirovskiy, Y Lai - Analytical chemistry, 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac8024009 Utilizing a Dual Human Transporter MDCKII-MDR1-BCRP Cell Line to Assess Efflux at the Blood Brain Barrier N Colclough, RV Alluri, JW Tucker, E Gozalpour - Drug Metabolism and , 2024 - ASPEThttps://dmd.aspetjournals.org/content/52/2/95.abstract Atlas of Membrane Transporter Proteins: Development and Application of a Highly Sensitive Simultaneous LC/MS/MS Method Combined with Novel In-silico Peptide J Kamiie, S Ohtsuki , R Iwase, K Ohmine - Pharmaceutical , 2008 - Springerhttps://link.springer.com/article/10.1007/s11095-008-9532-4 Comparison of LC-MS/MS-based targeted proteomics and conventional analytical methods for monitoring breast cancer resistance protein expression H Li , F Meng, L Jiang, Y Ren, Z Qiu, P Yu, J Peng - Life sciences, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0024320519304746

Peptide H-FRDYVDRFYKTLRAEQASQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FRDYVDRFYKTLRAEQASQD-OH include the following: Human immunodeficiency virus type 1 Nef induces programmed death 1 expression through a p38 mitogen-activated protein kinase-dependent mechanism K Muthumani, AY Choo, DJ Shedlock , DJ Laddy - Journal of , 2008 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.00485-08 Four novel cytotoxic T-lymphocyte epitopes in the highly conserved major homology region of HIV-1 Gag, restricted through B* 4402, B* 1801, A* 2601, B* 70 (B* 1509 GS Ogg , T Dong , P Hansasuta , L Dorrell, J Clarke - Aids, 1998 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/1998/12000/four_novel_cytotoxic_t_lymphocyte_epitopes_in_the.26.aspx

Peptide H-CTFEYVSQPFLMDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CTFEYVSQPFLMDLE-OH include the following: SARS-CoV-2 mRNA vaccination elicits a robust and persistent T follicular helper cell response in humans PA Mudd, AA Minervina , MV Pogorelyy , JS Turner - Cell, 2022 - cell.comhttps://www.cell.com/cell/pdf/S0092-8674(21)01489-6.pdf

Allatostatin II acetate (123374-34-5 free base) is an inhibitor of juvenile hormone synthesis in insects.

Peptide H-RRKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RRKRR-OH include the following: 7B2 facilitates the maturation of proPC2 in neuroendocrine cells and is required for the expression of enzymatic activity. X Zhu, I Lindberg - The Journal of cell biology, 1995 - rupress.orghttps://rupress.org/jcb/article-abstract/129/6/1641/20748 Novel point mutations in GDF5 associated with two distinct limb malformations in Chinese: brachydactyly type C and proximal symphalangism W Yang, L Cao, W Liu, L Jiang, M Sun - Journal of human , 2008 - nature.comhttps://www.nature.com/articles/jhg200846 Nuclear import of protein kinases and cyclins T Boulikas - Journal of cellular biochemistry, 1996 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1097-4644(19960101)60:1%3C61::AID-JCB10%3E3.0.CO;2-N Mapping of a functional region conferring nuclear localization of pseudorabies virus immediate-early protein S Taharaguchi, E Ono, S Yamada, Y Shimizu - Archives of virology, 1995 - Springerhttps://link.springer.com/article/10.1007/BF01384338 Conventional and neo-antigenic peptides presented by beta cells are targeted by circulating naaca¯ve CD8+ T cells in type 1 diabetic and healthy donors S Gonzalez-Duque, ME Azoury, ML Colli , G Afonso - Cell metabolism, 2018 - cell.comhttps://www.cell.com/cell-metabolism/pdf/S1550-4131(18)30450-9.pdf Compound heterozygosity for GDF5 in Du Pan type chondrodysplasia S Douzgou , K Lehmann, R Mingarelli - American Journal of , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ajmg.a.32435 7B2 is a specific intracellular binding protein of the prohormone convertase PC2 S Benjannet, D Savaria, M Chretien - Journal of , 1995 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1046/j.1471-4159.1995.64052303.x A novel insertion mutation in the cartilage-derived morphogenetic protein-1 (CDMP1) gene underlies Grebe-type chondrodysplasia in a consanguineous Pakistani S Basit , SKH Naqvi , N Wasif , G Ali , M Ansar - BMC medical , 2008 - Springerhttps://link.springer.com/article/10.1186/1471-2350-9-102 beta cell P SCG, ISL UCN - 2023 - iris.unito.ithttps://iris.unito.it/retrieve/e27ce42d-86cd-2581-e053-d805fe0acbaa/2018_Gonzalez-Duque%20et%20al%2C%20Cell%20Metab%2C%20in%20press.pdf Multifunctional basic motif in the glycine receptor intracellular domain induces subunit-specific sorting 2 N Melzer, C Villmann, K Becker, K Harvey - Journal of biological , 2010 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)81043-6/abstract Characterization of an acromesomelic dysplasia, Grebe type case: novel mutation affecting the recognition motif at the processing site of GDF5 M Martinez-Garcia , E Garcia-Canto - Journal of bone and , 2016 - Springerhttps://link.springer.com/article/10.1007/s00774-015-0693-z Control of the nuclear localization of Extradenticle by competing nuclear import and export signals M Abu-Shaar, HD Ryoo , RS Mann - Genes & development, 1999 - genesdev.cshlp.orghttps://genesdev.cshlp.org/content/13/8/935.short Structural basis for the recognition of HCoV-HKU1 by human TMPRSS2 L Xia, Y Zhang, Q Zhou - Cell Research, 2024 - nature.comhttps://www.nature.com/articles/s41422-024-00958-9 Structural analysis and proteolytic processing of recombinant G domain of mouse laminin alpha2 chain JF Talts, K Mann, Y Yamada, R Timpl - FEBS letters, 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579398003123 Molecular cloning and expression of a porcine chondrocyte nucleotide pyrophosphohydrolase I Masuda, BD Halligan , JT Barbieri, AL Haas , LM Ryan - Gene, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378111997002722 Length of the TM3-4 loop of the glycine receptor modulates receptor desensitization G Langlhofer, D Janzen, H Meiselbach, C Villmann - Neuroscience Letters, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304394015004607 The role of charged residues in independent glycine receptor folding domains for intermolecular interactions and ion channel function G Langlhofer, C Villmann - Journal of Neurochemistry, 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/jnc.14049 Brachydactyly type A2 associated with a defect in proGDF5 processing F Plöger, P Seemann - Human molecular , 2008 - academic.oup.comhttps://academic.oup.com/hmg/article-abstract/17/9/1222/569956 Crystal structure of the LG1-3 region of the laminin alpha2 chain F Carafoli, NJ Clout, E Hohenester - Journal of biological chemistry, 2009 - ASBMBhttps://www.jbc.org/article/S0021-9258(17)30783-4/abstract Suppression of pseudorabies virus replication by a mutant form of immediate-early protein IE180 repressing the viral gene transcription E Ono, S Taharaguchi, S Watanabe, H Nikami - Veterinary , 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378113597001533 Nuclear targeting of proteins: how many different signals? D Christophe, C Christophe-Hobertus, B Pichon - Cellular signalling, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0898656800000772 Proteases and variants: context matters for SARS-CoV-2 entry assays CS Stevens , KY Oguntuyo , B Lee - Current opinion in virology, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1879625721000754 DNA nucleotide sequence analysis of the immediate-early gene of pseudorabies virus AK Cheung - Nucleic acids research, 1989 - academic.oup.comhttps://academic.oup.com/nar/article-abstract/17/12/4637/2377018 The polybasic insert, the RBD of the SARS-CoV-2 spike protein, and the feline coronavirus-evolved or yet to evolve A Budhraja , S Pandey, S Kannan, CS Verma - and Biophysics Reports, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2405580821000017

A synthetic peptide for use as a blocking control in assays to test for specificity of CPB2 antibody, catalog no. 70R-5364

A synthetic peptide for use as a blocking control in assays to test for specificity of MST1 antibody, catalog no. 70R-5281

Peptide H-YDVDTLDMVFLDHWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YDVDTLDMVFLDHWK-OH include the following: Assess of catechol-O-methyltransferase soluble isoform by multiple reaction monitoring mass spectrometry JMS Diogo - 2016 - search.proquest.comhttps://search.proquest.com/openview/ad859c269e17145b511a08fe8d7f0118/1?pq-origsite=gscholar&cbl=2026366&diss=y

Peptide H-TPENYPNAGLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TPENYPNAGLTR^-OH include the following: An LC-MS-based designated comparison method with similar performance to the Lp (a) reference measurement procedure to guide molar Lp (a) standardization NM Diederiks, LR Ruhaak , FP Romijn, MM Pieterse - Clinical Proteomics, 2024 - Springerhttps://link.springer.com/article/10.1186/s12014-023-09446-5 Romi n NM Diederiks, LR Ruhaak - , Smit, NPM, & , 2024 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A3720868/download Development of an LC-MRM-MS-based candidate reference measurement procedure for standardization of serum apolipoprotein (a) tests LR Ruhaak , FP Romijn, I Begcevic Brkovic - Clinical , 2023 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/69/3/251/6987871 Romi n LR Ruhaak - FPHTM, Brko ic, IB, Kuklen ik, Z , 2023 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A3618803/download Commutability assessment of candidate reference materials for lipoprotein (a) by comparison of a MS-based candidate reference measurement procedure with I Dikaios, H Althaus, E Angles-Cano - Clinical , 2023 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/69/3/262/6987870

Peptide H-WPTLQWA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WPTLQWA-OH include the following: Characterization of epitopes for virus-neutralizing monoclonal antibodies to Ross River virus E2 using phage-displayed random peptide libraries JM Davies, YP Cai, RC Weir, MJ Rowley - Virology, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682200904744

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF624 antibody, catalog no. 70R-7960

H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF226 antibody, catalog no. 70R-8089

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of APBB2 antibody, catalog no. 70R-5679

A synthetic peptide for use as a blocking control in assays to test for specificity of NUP50 antibody, catalog no. 70R-3057

A synthetic peptide for use as a blocking control in assays to test for specificity of CBP tag antibody, catalog no. 70R-12226

Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLYSFPEP^EA-OH include the following: Allogeneic tumor antigen-specific T cells for broadly applicable adoptive cell therapy of cancer Z Molvi , RJ O'Reilly - Cancer Immunotherapies: Solid Tumors and , 2022 - Springerhttps://link.springer.com/chapter/10.1007/978-3-030-96376-7_4 War and Remission: Phosphopeptides, Fusion Proteins, and Predictive Biomarkers in Cancer Immunotherapy Z Molvi - 2023 - search.proquest.comhttps://search.proquest.com/openview/2d40a6573987b63d60263c9e2cd6ec47/1?pq-origsite=gscholar&cbl=18750&diss=y Functional regulatory immune responses against human cartilage glycoprotein-39 in health vs. proinflammatory responses in rheumatoid arthritis JHM van Bilsen , H van Dongen - Proceedings of the , 2004 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0407704101 Efficient identification of novel Hla-A* 0201-Presented Cytotoxic T Lymphocyte epitopes in the widely expressed tumor antigen prame by Proteasome-Mediated JH Kessler, NJ Beekman, SA Bres-Vloemans - The Journal of , 2001 - rupress.orghttps://rupress.org/jem/article-abstract/193/1/73/20096 Competition-based cellular peptide binding assays for 13 prevalent HLA class I alleles using fluorescein-labeled synthetic peptides JH Kessler, B Mommaas, T Mutis, I Huijbers - Human immunology, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0198885902007875 Competition-based cellular peptide binding assays for 15 prevalent HLA B Mommaas, I Huijbers, D Vissers, W Benckhuijsen - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A2864696/download

A synthetic peptide for use as a blocking control in assays to test for specificity of C4orf19 antibody, catalog no. 70R-8540

A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1G1 antibody, catalog no. 20R-1168

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A4 antibody, catalog no. 70R-7294

A synthetic peptide for use as a blocking control in assays to test for specificity of PIM2 antibody, catalog no. 70R-9160

Big Endothelin-2 is a 38 amino acid peptide formed as a result of furin cleavage of proendothelin which in turn is produced from EDN2 gene transcription. Due to the actions of the Endothelin-Converting Enzymes: ECE-1 and ECE-2, Big Endothelin-2 is converted into Endothelin-2 (ET-2) peptide. ET-2 has affinity for ETA and ETB G-protein coupled receptors which are found in a variety of tissues, including lungs, heart, kidneys, uterus and vasculature. It is believed that ET-2 is a potent vasoconstrictor and may play a role in cancer, immunology and heart failure. This product has is available as a 0.1mg vial.

A synthetic peptide for use as a blocking control in assays to test for specificity of TGS1 antibody, catalog no. 70R-2563

Peptide H-GQWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GQWS-OH include the following: Functional role and modulation of a calcium-activated potassium current in rat supraoptic neurons in vitro. K Kirkpatrick - 1999 - library-archives.canada.cahttps://library-archives.canada.ca/eng/services/services-libraries/theses/Pages/item.aspx?idNumber=47161175

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B1 antibody, catalog no. 70R-1332

Peptide H-RCGPDCFDNYGRYKYCF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RCGPDCFDNYGRYKYCF-NH2 include the following: Fetal dermal mesenchymal stem cell-derived exosomes accelerate cutaneous wound healing by activating notch signaling X Wang, Y Jiao, Y Pan, L Zhang, H Gong - Stem Cells , 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2019/2402916 Notch signaling is associated with ALDH activity and an aggressive metastatic phenotype in murine osteosarcoma cells X Mu , C Isaac , N Greco, J Huard , K Weiss - Frontiers in oncology, 2013 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2013.00143/full Tbx1 regulates brain vascularization S Cioffi, S Martucciello, FG Fulcoli - Human Molecular , 2014 - academic.oup.comhttps://academic.oup.com/hmg/article-abstract/23/1/78/722596 Involvement of notch signaling in wound healing S Chigurupati , TV Arumugam , TG Son, JD Lathia - PloS one, 2007 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0001167 Cell-autonomous notch signaling regulates endothelial cell branching and proliferation during vascular tubulogenesis RCA Sainson , J Aoto , MN Nakatsu - The FASEB , 2005 - Wiley Online Libraryhttps://faseb.onlinelibrary.wiley.com/doi/abs/10.1096/fj.04-3172fje Targeting Notch pathway induces growth inhibition and differentiation of neuroblastoma cells G Ferrari-Toninelli, SA Bonini, D Uberti - Neuro , 2010 - academic.oup.comhttps://academic.oup.com/neuro-oncology/article-abstract/12/12/1231/1130248 Notch signaling activation contributes to paclitaxel-induced neuropathic pain via activation of A1 astrocytes DY Li, SJ Gao, J Sun, LQ Zhang, JY Wu - European Journal of , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014299922003910 Jagged-1 mediated activation of notch signaling induces complete maturation of human keratinocytes through NF-κB and PPARγ BJ Nickoloff, JZ Qin, V Chaturvedi - Cell Death & , 2002 - nature.comhttps://www.nature.com/articles/4401036 ALK1 signaling inhibits angiogenesis by cooperating with the Notch pathway B Larrivee , C Prahst , E Gordon , R del Toro , T Mathivet - Developmental cell, 2012 - cell.comhttps://www.cell.com/developmental-cell/pdf/S1534-5807(12)00086-X.pdf

Peptide H-ESLSSYWESAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ESLSSYWESAK^-OH include the following: Robust and accurate 2-year performance of a quantitative mass spectrometry-based apolipoprotein test in a clinical chemistry laboratory LR Ruhaak , NPM Smit, FP Romijn - Clinical , 2018 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/64/4/747/5608792 Romi n, FPHTM, Pieterse, MM, Laarse,. an der, Burgt LR Ruhaak , NPM Smit - EM an der, & , 2018 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A3004628/download Serum proteomic analysis of major depressive disorder patients and their remission status: novel biomarker set of zinc-alpha-2-glycoprotein and keratin type II H Choi, S Mun, EJ Joo, KY Lee, HG Kang - International Journal of , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0141813021011533 depth and breadth of plasma protein quantitation via two-dimensional liquid chromatography/multiple reaction monitoring-mass spectrometry with labeled peptide AJ Percy , J Yang, AG Chambers - Quantitative Proteomics by , 2016 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-3524-6_1

A synthetic peptide for use as a blocking control in assays to test for specificity of ISL2 antibody, catalog no. 20R-1151

Peptide H-VNHAVLAVGYGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VNHAVLAVGYGEK-OH include the following: MODplus: robust and unrestrictive identification of post-translational modifications using mass spectrometry S Na , J Kim, E Paek - Analytical chemistry, 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.9b02445 Human B lymphoblastoid cells contain distinct patterns of cathepsin activity in endocytic compartments and regulate MHC class II transport in a cathepsin S A Lautwein, M Kraus, M Reich, T Burster - Journal of Leucocyte , 2004 - academic.oup.comhttps://academic.oup.com/jleukbio/article-abstract/75/5/844/6976306

Peptide H-GLEWVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLEWVAR^-OH include the following: and Takashi Shimada N Iwamoto, N Yamane, Y Umino, A Hamadac - researchgate.nethttps://www.researchgate.net/profile/Akinobu-Hamada/publication/283003878_Development_of_the_validated_LCMS_bioanalysis_of_Trastuzumab_in_human_plasma_using_selective_detection_method_for_complementarity-determining_regions_of_monoclonal_antibody_nano-surface_and_molecular-/links/56582f5008aefe619b207dac/Development-of-the-validated-LCMS-bioanalysis-of-Trastuzumab-in-human-plasma-using-selective-detection-method-for-complementarity-determining-regions-of-monoclonal-antibody-nano-surface-and-molecular.pdf The development of the validated LCMS bioanalysis of trastuzumab in human plasma using a selective detection method for complementarity-determining regions of N Iwamoto, N Yamane, Y Umino, A Hamada - Analytical , 2015 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2015/ay/c5ay01588j

A synthetic peptide for use as a blocking control in assays to test for specificity of GCLC antibody, catalog no. 70R-9275

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F1 antibody, catalog no. 70R-7103

Peptide H-YLYHRVDVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YLYHRVDVI-OH include the following: T cell antigen discovery via trogocytosis G Li , MT Bethune , S Wong , AV Joglekar, MT Leonard - Nature , 2019 - nature.comhttps://www.nature.com/articles/s41592-018-0305-7

Selective NOP receptor partial agonist peptide; Ki=0.71 nM; >4000 nM for μ, δ, κ receptors; boosts food intake in vivo.

Potent, selective bradykinin receptor agonist 50x stronger than bradykinin, contracts guinea pig ileum muscle at EC50 4.0 nM.

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC34821 antibody, catalog no. 70R-4292

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A8 antibody, catalog no. 70R-7008

H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is designed for the synthesis of peptides. It can be used as a building block and has been shown to react with thiols, alcohols, amines, and other building blocks. RESIN: H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GSESGIFTNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GSESGIFTNTK^-OH include the following: Quantitative serum proteomic study reveals that fibrinogen-related proteins may participate in the pathophysiological process of simple febrile convulsion C Li, X Zhao, Y Zhao, X Liu, J Zhang, S Li - Journal of the , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.9b00100 Standardized protocols for quality control of MRM-based plasma proteomic workflows AJ Percy , AG Chambers, DS Smith - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr300893w

Cbz-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Cbz-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Amphibian bombesin-like peptide

Peptide H-V^V^GGLV^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-V^V^GGLV^ALR^-OH include the following: Reagent for evaluating liquid chromatography-tandem mass spectrometry (LC-MS/MS) performance in bottom-up proteomic experiments J Beri, MM Rosenblatt, E Strauss, M Urh - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.5b04121

Peptide H-GPRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GPRP-NH2 include the following: Characterization of a Recombinant Chimeric Plasminogen Activator Composed of Gly-Pro-Arg-Pro Tetrapeptide and Truncated Urokinase-Type Plasminogen ZC Hua , XC Chen, C Dong, DX Zhu - Biochemical and biophysical , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X9690786X Crystal Structure of Fragment D from Lamprey Fibrinogen Complexed with the Peptide Gly-His-Arg-Pro-amide, Z Yang , G Spraggon, L Pandi, SJ Everse, M Riley - Biochemistry, 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi020299t Chemical conjugation of Gly-Pro-Arg-Pro tetrapeptide to low molecular weight urokinase XC Chen, ZC Hua , DX Zhu - IUBMB Life, 1996 - Wiley Online Libraryhttps://iubmb.onlinelibrary.wiley.com/doi/abs/10.1080/15216549600201501 In vitro fibrinolysis and antithrombosis characterizations of novel recombinant microplasminogen with RGD and GPRP peptides W Chen, Y Li, P Chen, M Wu, L Wang, H Zhang - Journal of thrombosis , 2016 - Springerhttps://link.springer.com/article/10.1007/s11239-016-1334-7 Purification and characterization of a glycosylated proline-rich protein from human parotid saliva T Oho, F Rahemtulla, B MacaÂ¥nsson-Rahemtulla - International journal of , 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0020711X9290387G Polymerization-defective fibrinogen variant γD364A binds knob"A" peptide mimic SR Bowley, BK Merenbloom, N Okumura, L Betts - Biochemistry, 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi8000769 Conformational Changes in Fragments D and Double-D from Human Fibrin(ogen) upon Binding the Peptide Ligand Gly-His-Arg-Pro-Amide, SJ Everse, G Spraggon, L Veerapandian - Biochemistry, 1999 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi982626w Alterations in fibrin microstructure via competitive knob peptides and the implications for cellular response SE Stabenfeldt , MJ Gourley, NM Aboujamous - abstracts.biomaterials.orghttp://abstracts.biomaterials.org/data/papers/2010/443.pdf Building better fibrin knob mimics: an investigation of synthetic fibrin knob peptide structures in solution and their dynamic binding with fibrinogen/fibrin holes SE Stabenfeldt , JJ Gossett - Blood, The Journal of the , 2010 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/116/8/1352/27876 Gly-pro-arg-pro (GPRP) enhances free thrombin S Gallistl, W Muntean, W Zenz - Thrombosis research, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0049384895E00888 Localization of the domains of fibrin involved in binding to platelets RR Hantgan - Biochimica et Biophysica Acta (BBA)-Molecular Cell , 1988 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167488988900419 Powerful Binders for the D-Dimer by Conjugation of the GPRP Peptide to Polypeptides from a Designed Set Illustrating a General Route to New Binders for Proteins R Ramapanicker, X Sun, J Viljanen - Bioconjugate , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc300186z Characterization of nociceptin receptors in the periphery: in vitro and in vivo studies R Bigoni, S Giuliani, G Calo' , A Rizzi, R Guerrini - Naunyn-Schmiedeberg's , 1999 - Springerhttps://link.springer.com/article/10.1007/PL00005338 Inhibition effect of Gly-Arg-Gly-Asp-Ser (GRGDS) and Arg-Gly-Asp (RGD) Bioactive Peptides on Angiotensin-Converting Enzyme Activity Purified from Human Serum R AdanaÃ…Åž, V TurkoÄŞlu , Z BaÃ…Åž - Journal of the Institute of Science and , 2023 - dergipark.org.trhttps://dergipark.org.tr/en/pub/jist/issue/80709/1312143 2.8 aca
 crystal structures of recombinant fibrinogen fragment D with and without two peptide ligands: GHRP binding to the"b" site disrupts its nearby calcium-binding site MS Kostelansky, L Betts, OV Gorkun, ST Lord - Biochemistry, 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0261894 Gastrin-releasing peptide receptor-mediated autocrine growth in squamous cell carcinoma of the head and neck MN Lango, KF Dyer, VWY Lui - Journal of the , 2002 - academic.oup.comhttps://academic.oup.com/jnci/article-abstract/94/5/375/2520087 Effects of fibrinogen-binding tetrapeptides on mechanical properties of fine fibrin clots. MD Bale, MF Muller, JD Ferry - Proceedings of the National , 1985 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.82.5.1410 Desert LocustSchistocerca gregariaContains a Glycine-and Proline-Rich Peptide That Displays Sequence Similarities with a New Class of GPRP Proteins from Plants L Schoofs , A Hamdaoui, B Devreese - Biochemical and , 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X98981049 The structure of fibrinogen fragment D with the 'A'knob peptide GPRVVE L Betts, BK Merenbloom, ST Lord - Journal of Thrombosis and , 2006 - jthjournal.orghttps://www.jthjournal.org/article/S1538-7836(22)12241-5/abstract The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal γ chain fragment complexed with the peptide Gly-Pro-Arg-Pro KP Pratt , HCF Cote , DW Chung - Proceedings of the , 1997 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.94.14.7176 Effects on rotavirus cell binding and infection of monomeric and polymeric peptides containing alpha2beta1 and alphaxbeta2 integrin ligand sequences KL Graham, W Zeng , Y Takada , DC Jackson - Journal of , 2004 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.78.21.11786-11797.2004 Effects on rotavirus cell binding and infection of monomeric and polymeric peptides containing 21 and x2 integrin ligand sequences KL Graham, W Zeng , Y Takada , DC Jackson - J. Virol, 2004 - academia.eduhttps://www.academia.edu/download/96263864/11786.pdf Gly-Pro-Arg-Pro modifies the glutamine residues in the alpha-and γ-chains of fibrinogen: inhibition of transglutaminase cross-linking KE Achyuthan, JV Dobson, CS Greenberg - Biochimica et Biophysica Acta , 1986 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167483886902797 Thrombin interaction with fibrin polymerization sites K Hsieh - Thrombosis research, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S004938489700073X Localization of an Effective Fibrin beta-Chain Polymerization Site: Implications for the Polymerization Mechanism K Hsieh - Biochemistry, 1997 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi962741b Peptide-derivatized albumins that inhibit fibrin polymerization JW Watson, RF Doolittle - Biochemistry, 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi201406c Molecular characterization of the gene coding for GPRP, a class of proteins rich in glycine and proline interacting with membranes in Arabidopsis thaliana I Marty, A Monfort, V Stiefel, D Ludevid, M Delseny - Plant molecular , 1996 - Springerhttps://link.springer.com/article/10.1007/BF00049336 Molecular cloning and characterisation of genes coding for glycine-and proline-rich proteins (GPRPs) in soybean H Peng , Y Feng, H Zhang, X Wei, S Liang - Plant Molecular Biology , 2012 - Springerhttps://link.springer.com/article/10.1007/s11105-011-0363-9 Insertion of fibrin peptides into urokinase enhances fibrin affinity GA Homandberg, T Wai - Thrombosis research, 1990 - Elsevierhttps://www.sciencedirect.com/science/article/pii/004938489090211T Use of monolithic sorbents modified by directly synthesized peptides for affinity separation of recombinant tissue plasminogen activator (t-PA) E Vlakh , N Ostryanina, A Jungbauer - Journal of biotechnology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168165603002955 Initial interaction between fibrin and tissue plasminogen activator (t-PA). The Gly-Pro-Arg-Pro binding site on fibrin (ogen) is important for t-PA activity. E Kaczmarek, MH Lee, J McDonagh - Journal of Biological Chemistry, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S002192581853800X Localization of the cross-linking site of GPRVVERHK in the γ-chain of human fibrinogen CS Cierniewski, AZ Budzynski - European journal of , 1993 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1432-1033.1993.tb18380.x Synthesis, purification, and properties of a peptide that enhances the activation of human [Glu1]plasminogen by tissue plasminogen activator and retards fibrin BAK CHIBBER , S URANO - Journal of Peptide and , 1990 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00723.x Synergistic inhibition of platelet aggregation by fibrinogen-related peptides. B Adelman, C Gennings , J Strony - Circulation research, 1990 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/01.res.67.4.941 Modulation of fibrin matrix properties via knob: hole affinity interactions using peptide-PEG conjugates ASC Soon, CS Lee, TH Barker - Biomaterials, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961211002274 Platelet activation by thrombin can be directly measured in whole blood through the use of the peptide GPRP and flow cytometry: methods and clinical applications AD Michelson - Blood coagulation & fibrinolysis, 1994 - journals.lww.comhttps://journals.lww.com/bloodcoagulation/abstract/1994/02000/platelet_activation_by_thrombin_can_be_directly.14.aspx Interaction of the fibrinogen-binding tetrapeptide gly-pro-arg-pro with fine clots and oligomers of alpha-fibrin; comparison with alphabeta-fibrin A Shimizu, G Schindlauer - : Original Research on , 1988 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360270506 Peptides as affinity surfaces for protein purification A Pingali, B McGuinness, H Keshishian - Journal of Molecular , 1996 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1099-1352(199634/12)9:5/6%3C426::AID-JMR279%3E3.0.CO;2-S

Anti-Substance P Serum is a high purity protein that specifically binds to the receptor for substance P, which is a peptide hormone. This product has an affinity for the high affinity binding site of the receptor and inhibits the activity of substance P. Anti-Substance P Serum is used as a research tool in pharmacology and cell biology, as well as in antibody production.

26RFa acetate is a hypothalamic neuropeptide with orexigenic activity in mammals[1].

A synthetic peptide for use as a blocking control in assays to test for specificity of DAB1 antibody, catalog no. 70R-4084

BQ-3020 (TFA) is a selective ETB agonist with a 0.2nm IC50, blocking [125I] ET-1 in the cerebellum and causing vasoconstriction.

Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons- astrocytes- microglia- epithelial cells- endothelial cells- immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.

A synthetic peptide for use as a blocking control in assays to test for specificity of LRG1 antibody, catalog no. 70R-4512

Peptide H-GQNDTSQTSSPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GQNDTSQTSSPS-OH include the following: The sperm agglutination antigen-1 (SAGA-1) glycoforms of CD52 are O-glycosylated S Parry, NK Wong , RL Easton, M Panico - , 2007 - academic.oup.comhttps://academic.oup.com/glycob/article-abstract/17/10/1120/1987838 Mapping the epitopes of antibodies RC Ladner - Biotechnology and Genetic Engineering Reviews, 2007 - Taylor & Francishttps://www.tandfonline.com/doi/pdf/10.1080/02648725.2007.10648092 Alemtuzumab scFv fragments and CD52 interaction study through molecular dynamics simulation and binding free energy NF Frota, A de Sousa Rebouaca, CA Fuzo - Journal of Molecular , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1093326321001200 The Bcl-2 family as a rational target for the treatment of B-cell chronic lymphocytic leukaemia N Capitani, CT Baldari - Current medicinal chemistry, 2010 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cmc/2010/00000017/00000009/art00001 Structure of the CAMPATH-1 antigen, a glycosylphosphatidylinositol-anchored glycoprotein which is an exceptionally good target for complement lysis MQ Xia, G Hale, MR Lifely, MAJ Ferguson - Biochemical , 1993 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/293/3/633/30420 Immmunity to Sperm: Auto and Iso Immunization K Koyama - Immunology of Pregnancy, 2013 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=ie4YDgAAQBAJ&oi=fnd&pg=PA59&dq=(%22GQNDTSQTSSPS%22+OR+%22H-GQNDTSQTSSPS-OH%22)+AND+peptide&ots=uscUTMM2i6&sig=gGxIBHibtKCGYSjEbfRa8aW3pj4 Immmunity to Sperm: Auto and Iso Immunization K Koyama - Immunology of Pregnancy, 2013 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=ie4YDgAAQBAJ&oi=fnd&pg=PA59&dq=(%22GQNDTSQTSSPS%22+OR+%22H-GQNDTSQTSSPS-OH%22)+AND+peptide&ots=uscUTMM3bd&sig=RUA6_wFPXW_0dD-1uqlCFMIfU_E Development of Immunocontraceptives in Female H Shibahara - Gamete Immunology, 2022 - Springerhttps://link.springer.com/chapter/10.1007/978-981-16-9625-1_13 Crystal structures of a rat anti-CD52 (CAMPATH-1) therapeutic antibody Fab fragment and its humanized counterpart GMT Cheetham, G Hale, H Waldmann - Journal of molecular , 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S002228369892157X Synthetic peptide mimotope of the CAMPATH-1 (CD52) antigen, a small glycosylphosphatidylinositol-anchored glycoprotein G Hale - Immunotechnology, 1995 - Elsevierhttps://www.sciencedirect.com/science/article/pii/1380293395000178 T cell regulation mediated by interaction of soluble CD52 with the inhibitory receptor Siglec-10 E Bandala-Sanchez, Y Zhang , S Reinwald - Nature , 2013 - nature.comhttps://www.nature.com/articles/ni.2610 Ð ÐÐ¡Ð¢Ð’ÐşÐ Ð˜ÐœÐ«Ð™ ÐœÐ•Ð”Ð˜ÐÐ¢ÐşÐ  СЭ БАНДАЛА, Д Ð”Ð ÐşÐœÐ˜, ЛÐhttps://elibrary.ru/item.asp?id=41038063 Nasal immunization with diphtheria toxoid conjugated-CD52 core peptide induced specific antibody production in genital tract of female mice A Hasegawa, Y Fu, K Koyama - American Journal of , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1600-0897.2002.01135.x Epitope analysis for human sperm-immobilizing monoclonal antibodies, MAb H6-3C4, 1G12 and campath-1 A Hasegawa, Y Fu, H Tsubamoto, Y Tsuji - Molecular human , 2003 - academic.oup.comhttps://academic.oup.com/molehr/article-abstract/9/6/337/1002862 CD52 is synthesized in cumulus cells and secreted into the cumulus matrix during ovulation A Hasegawa, T Takenobu, H Kasumi - American Journal of , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1600-0897.2008.00611.x Possible presence of O-linked carbohydrate in the human male reproductive tract CD52 A Hasegawa, H Sawai, H Tsubamoto, M Hori - Journal of reproductive , 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165037804000397