Peptides

A synthetic peptide for use as a blocking control in assays to test for specificity of IL28RA antibody, catalog no. 70R-7458

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of MTNR1A antibody, catalog no. 70R-10327

A synthetic peptide for use as a blocking control in assays to test for specificity of F13B antibody, catalog no. 70R-5445

A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN1 antibody, catalog no. 70R-1877

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Please enquire for more information about Caspase 3 Substrate 1m (Apopain), fluorogenic including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of SGPP1 antibody, catalog no. 70R-8844

A synthetic peptide for use as a blocking control in assays to test for specificity of ETHE1 antibody, catalog no. 70R-9299

Peptide H-LTVGAAQVPAQLLVGALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LTVGAAQVPAQLLVGALR-OH include the following: Proteomic changes in cerebrospinal fluid from primary central nervous system lymphoma patients are associated with protein ectodomain shedding DM Waldera-Lupa, O Etemad-Parishanzadeh - Oncotarget, 2017 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5746369/

RR-src acetate is a synthetic peptide derived from the amino acid sequence surrounding the phosphorylation site in pp60src.

FGF21 is a protein that in humans is encoded by the FGF21 gene. It is a member of the fibroblast growth factor (FGF) family and was originally identified as an anti-diabetic hormone that regulates glucose homeostasis. FGF21 also has roles in lipid metabolism and regulation of energy homeostasis, such as through its interactions with PPARs, RXRs, LXRs, and other nuclear receptors. The receptor for FGF21 is FGFR1c and it acts as a high-affinity agonist of this receptor. The ligand for FGFR1c is FGF19.

Amylin, also known as islet amyloid polypeptide (IAPP), is a peptide hormone which is deficient in patients with diabetes mellitus (DM). Amylin is co-secreted with insulin from the pancreatic β-cells. It inhibits glucagon secretion, delays gastric emptying, and thus acts as a satiety agent.  Amylin peptide is capable of forming aggregates, and pancreatic amyloid plaques are present in 90% of patients with DM. Formation of these plaques may be inhibited by insulin via the formation of heteromolecular complexes. Amylin is also involved in adiposity signalling and body weight regulation.Amylin is expressed in the human placenta during pregnancy where it may help regulate food intake by both the mother and foetus, and is involved in foetal development of bone, kidneys and pancreas.

Peptide H-YLAEFATGNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YLAEFATGNDR^-OH include the following: Proteomic analysis of human vitreous humor KR Murthy, R Goel , Y Subbannayya , HKC Jacob - Clinical proteomics, 2014 - Springerhttps://link.springer.com/article/10.1186/1559-0275-11-29 Mass spectrometry for comparative proteomics of degenerative and regenerative processes in the brain C Sihlbom - 2006 - gupea.ub.gu.sehttps://gupea.ub.gu.se/handle/2077/774

Human epidermal growth factor receptor (HER-2)/epidermal growth factor receptor-2 (ErbB-2), is a key receptor linked to metastasis in tumours. The oncogenic ErbB-2 receptor has intrinsic receptor tyrosine kinase (RTK) activity, the receptor is activated by ligand binding which induces receptor dimerization. These RTK complexes can activate mitogen-activated protein kinase (MAPK) and phosphoinositol 3-kinase (PI3K)/Akt pathways. This peptide has been identified as a substrate for HER-2/ErbB-2 as it is phosphorylated upon receptor activation and therefore acts as a marker for receptor activation in kinases assays. Contains a covalently attached N-terminal biotin tag for convenient detection and purification.

Modified HIV TAT Sequence 49-57 for Click Chemistry. Product available as a trifluoroacetate salt

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCC1 antibody, catalog no. 70R-1789

H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of Arsb antibody, catalog no. 70R-9612

Kallikrein-2 inhibitor

A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN17 antibody, catalog no. 70R-6679

H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is a peptide that was originally isolated from the venom of the Brazilian spider, Phoneutria nigriventer. This peptide has been shown to have anti tumor activity in mice by targeting and binding to the tumor cells. H-[Cys-Arg-Gly-Asp-Lys-Gly-Pro-Asp-Cys]-NH2 is also a cell penetrating peptide (CPP) that can penetrate into the cell and disrupts cancer cell growth. It is also a disulfide rich peptide with RGD sequence which binds to integrins on the surface of tumor cells and induces apoptosis.

Peptide H-GLPSIPVHPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLPSIPVHPI-OH include the following: TLR-9 signaling and TCR stimulation co-regulate CD8+ T cell-associated PD-1 expression RM Wong, KA Smith, VL Tam, RR Pagarigan - Immunology letters, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165247809002181

Peptide Ac-CETVFHRVSQDGLDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CETVFHRVSQDGLDL-NH2 include the following: Combined immunostimulation and conditional cytotoxic gene therapy provide long-term survival in a large glioma model S Ali, GD King, JF Curtin , M Candolfi, W Xiong, C Liu - Cancer research, 2005 - AACRhttps://aacrjournals.org/cancerres/article-abstract/65/16/7194/518123 Fms-like tyrosine kinase 3 ligand recruits plasmacytoid dendritic cells to the brain JF Curtin , GD King, C Barcia , C Liu - The Journal of , 2006 - journals.aai.orghttps://journals.aai.org/jimmunol/article/176/6/3566/75489 Fms-Like Tyrosine Kinase 3 Ligand Recruits IA Josien, PR Lowenstein , G Maria, C Liu, FX Hubert - J Immunol, 2006 - academia.eduhttps://www.academia.edu/download/87084021/3566.full.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM17 antibody, catalog no. 70R-8039

An apolipoprotein E N-term heavy tryptic peptide standard for use in protein identification and quantitation studies. As part of a fat-binding protein family, apolipoprotein E plays a role in the metabolism of fats in the body through interacting with the low density lipoprotein receptor, which is involved in the catabolism of triglyceride rich lipoproteins. Apolipoprotein E is also a major component in cholesterol metabolism and is a carrier of cholesterol in the brain. Additionally when forming a complex with C1q, apolipoprotein E is an inhibitor of the classical complement pathway. The N and C terminal regions of apolipoprotein are connected by a hinge region and the N-terminal region is an anti parallel four helix bundle with non-polar sides positioning themselves inside the protein.

A synthetic peptide for use as a blocking control in assays to test for specificity of TSKS antibody, catalog no. 70R-2687

Peptide H-AVHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVHI-OH include the following: Volumetric characterizations of protein denaturation and ligand binding R Filfil - 2000 - collectionscanada.gc.cahttps://www.collectionscanada.gc.ca/obj/s4/f2/dsk1/tape3/PQDD_0017/MQ54174.pdf Immunostained serotonergic fibers are decreased in selected brain regions of alcohol-preferring rats FC Zhou, S Bledsoe , L Lumeng, TK Li - Alcohol, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S074183299190034T

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNA5 antibody, catalog no. 70R-8013

Please enquire for more information about Bz-Nle-Lys-Arg-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-LSTSEIASHLPTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSTSEIASHLPTK-OH include the following: Understanding the role of proteolytic digestion on discovery and targeted proteomic measurements using liquid chromatography tandem mass spectrometry and PL Loziuk, J Wang , Q Li, RR Sederoff - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr4008442

H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of GSTZ1 antibody, catalog no. 70R-1182

A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf48 antibody, catalog no. 70R-4110

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM34 antibody, catalog no. 70R-8362

Peptide H-VADFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VADFGLAR-OH include the following: Membrane proteomic profiling enhances drug target detection HJ Chan , LY Chen , HC Chiu - Journal of the Chinese , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jccs.202200265

A synthetic peptide for use as a blocking control in assays to test for specificity of GINS2 antibody, catalog no. 70R-5625

Calcineurin Autoinhibitory Peptide acetate is a selectivecalcineurin phosphatase inhibitor(IC50 ~ 10 μM).

Peptide H-LPTDSELAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LPTDSELAPR^-OH include the following: Detection and characterization of selenoproteins by tandem mass spectrometry assisted by laser ablation inductively coupled plasma mass spectrometry: application G Ballihaut, LE Kilpatrick, EL Kilpatrick - Journal of Analytical , 2011 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2011/ja/c0ja00115e

Peptide H-GFLSKSLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GFLSKSLVF-OH include the following: Identification, Characterization, and Targeting of a Rare and Temporal Dendritic Cell State that Facilitates Adaptive Immune Responses P Deak , B Studnitzer, R Steinhardt , A Esser-Kahn - bioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.10.08.331744.abstract Novel ligands and modulators of triggering receptor expressed on myeloid cells receptor family: 2015-2020 updates H Singh , V Rai , SK Nooti - Expert opinion on , 2021 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/13543776.2021.1883587 Triggering receptor expressed on myeloid cells-1 (TREM-1) contributes to Bordetella pertussis inflammatory pathology D Gallop, KM Scanlon , J Ardanuy - Infection and , 2021 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.00126-21 Commentary: triggering receptor expressed on myeloid cells-1 inhibitor targeted to endothelium decreases cell activation AB Sigalov - Frontiers in Immunology, 2020 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2020.00173

Peptide H-DHSAIPVINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DHSAIPVINR^-OH include the following: Enhanced sensitivity and multiplexing with 2D LC/MRM-MS and labeled standards for deeper and more comprehensive protein quantitation AJ Percy , R Simon, AG Chambers, CH Borchers - Journal of proteomics, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391914002000

Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a cyclic peptide that has been shown to have antiangiogenic properties. It may be used as a linker for the conjugation of drugs to compounds with different target specificities. Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a negative control peptide that has the RGD sequence, which is the most common motif in peptides that are used for cell targeting. This peptide was tested against human ovarian carcinoma and inhibited endothelial cell proliferation and tumor vasculature formation. Cyclo(Arg-Ala-Asp-D-Phe-Lys) also inhibited angiogenesis in vitro and in vivo, suggesting that it may be useful for the treatment of cancer and other diseases involving abnormal blood vessel growth.

A synthetic peptide for use as a blocking control in assays to test for specificity of ASL antibody, catalog no. 70R-2867

PAR2 plays a particular role in protecting the gastric mucosa mediated by capsaicin-sensitive sensory neurons. PAR2 also serves to aid in gut smooth muscle motility- colon inflammation pathway- hyperalgesia and is also anti-inflammatory in other circumstances.Development of selective agonists for PAR2 are crucial for research. (2-Furoyl)-LIGRL-amide is a far more potent agonist than the native PAR2 activating peptide SLIGRL-NH2. In mice, oral administration conferred cytoprotection from gastrointestinal lesions. However, it was inhibited by capsaicin pre-treatment.

Azido-dPEG®4-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Peptide H-SLEGSDDAVLLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLEGSDDAVLLQR^-OH include the following: Characterization of the dystrophin-associated protein complex by mass spectrometry EH Canessa , R Spathis, JS Novak - Mass spectrometry , 2024 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/mas.21823 Absolute quantification of dystrophin protein in human muscle biopsies using parallel reaction monitoring (PRM) EH Canessa , MV Goswami , TD Alayi - Journal of mass , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.4437

A synthetic peptide for use as a blocking control in assays to test for specificity of TWF1 antibody, catalog no. 70R-3895

A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6067

Peptide H-VGYMHWYQQKPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGYMHWYQQKPGK^-OH include the following: Reducing metal-ion mediated adsorption of acidic peptides in RPLC-based assays using hybrid silica chromatographic surfaces RE Birdsall, J Kellett, S Ippoliti, N Ranbaduge - of Chromatography B, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157002322100180X

Peptide H-LCKLSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LCKLSL-OH include the following: The annexin A2 system and angiogenesis W Liu, KA Hajjar - Biological chemistry, 2016 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/hsz-2016-0166/html Specific interaction of tissue-type plasminogen activator (t-PA) with annexin II on the membrane of pancreatic cancer cells activates plasminogen and promotes VM Diaz, M Hurtado, TM Thomson , J Reventos - Gut, 2004 - gut.bmj.comhttps://gut.bmj.com/content/53/7/993.short Exosomal annexin II promotes angiogenesis and breast cancer metastasis S Maji , P Chaudhary , I Akopova, PM Nguyen - Molecular Cancer , 2017 - AACRhttps://aacrjournals.org/mcr/article-abstract/15/1/93/278201 Exosomal AnnexinA2' s Role In Angiogenesis And Breast Cancer Metastasis S Maji , J Vishwanatha - The FASEB Journal, 2015 - Wiley Online Libraryhttps://faseb.onlinelibrary.wiley.com/doi/abs/10.1096/fasebj.29.1_supplement.574.19 Abstract B26: Role of exosomal annexin a2 in angiogenesis and breast cancer metastasis S Maji , AM Leitch, I Akopova, P Nguyen - Molecular Cancer , 2015 - AACRhttps://aacrjournals.org/mct/article-abstract/14/12_Supplement_1/B26/285857 Role of Exosomal Annexin A2 in Angiogenesis and Breast Cancer Metastasis S Maji - 2015 - unthsc-ir.tdl.orghttps://unthsc-ir.tdl.org/bitstream/handle/20.500.12503/29143/2015_05_gsbs_Maji_Sayantan_dissertation.pdf Dissecting the MUC5AC/ANXA2 signaling axis: implications for brain metastasis in lung adenocarcinoma S Chaudhary , JA Siddiqui , MI Appadurai - & Molecular Medicine, 2024 - nature.comhttps://www.nature.com/articles/s12276-024-01255-6 416 KATHERINE A. HAJJAR RN Anticoagulant - Homocysteine in Health and Disease, 2001 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=BqsoZU5CwM0C&oi=fnd&pg=PA415&dq=(%22H-LCKLSL-OH%22+OR+%22LCKLSL%22)+AND+peptide&ots=38H4c-mxTo&sig=rxZjoLKwdkhLKUgrdpgtpfvegdI Methionine-induced hyperhomocysteinemia reverts fibrinolytic pathway activation in a murine model of acute promyelocytic leukemia RH Jacomo, BA Santana-Lemos - Blood, The Journal , 2012 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/120/1/207/30149 Annexins as potential targets in ocular diseases RA da Silva , VM de Paiva Roda - Drug Discovery , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1359644622003609 Extracellular vesicle proteins as breast cancer biomarkers: Mass spectrometry-based analysis R Bandu , JW Oh, KP Kim - Proteomics, 2024 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.202300062 Inhibition of endothelial cell thromboresistance by homocysteine Q Ling, KA Hajjar - The Journal of nutrition, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022316622110540 Serum exosomal-annexin A2 is associated with African-American triple-negative breast cancer and promotes angiogenesis P Chaudhary , LD Gibbs, S Maji , CM Lewis - Breast cancer , 2020 - Springerhttps://link.springer.com/article/10.1186/s13058-020-1251-8 New insights into the tPA-annexin A2 interaction: is annexin A2 Cys8 the sole requirement for this association? O Roda, ML Valero, S Peiro , D Andreu , FX Real - Journal of Biological , 2003 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)86553-3/abstract The role of annexin A2 in tumorigenesis and cancer progression NA Lokman , MP Ween , MK Oehler - Cancer , 2011 - Springerhttps://link.springer.com/article/10.1007/s12307-011-0064-9 A competitive hexapeptide inhibitor of annexin A2 prevents hypoxia-induced angiogenic events M Valapala, SI Thamake - Journal of cell , 2011 - journals.biologists.comhttps://journals.biologists.com/jcs/article-abstract/124/9/1453/32224 Cell surface translocation of annexin A2 facilitates glutamate-induced extracellular proteolysis M Valapala, S Maji , J Borejdo - Journal of Biological , 2014 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)33487-6/abstract Mechanisms of cell surface trafficking and potential functions of extracellular annexin a2 M Valapala - 2010 - search.proquest.comhttps://search.proquest.com/openview/adc8683f73b1de653b55789cdd43445b/1?pq-origsite=gscholar&cbl=18750 Cancer-associated fibroblasts support bone tropic metastasis by acting as coordinators between the tumor microenvironment and bone matrix in breast cancer. LI Hualing, LIN Xueguang, Y Di, C Zhangyue - , 2021 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=00282685&AN=149032548&h=aoU2syrEapzN9ljTuNFJjFTgak6yRQPNv%2FL6%2Fn4iyA8uhIhJlqlR3AXSPdBAuFirML1FigT%2FZR32CNlok9AV%2Bw%3D%3D&crl=c Clinical Significance of Annexin A2 in Predicting Poor Prognosis in African American Women with Triple-Negative Breast Cancer LD Gibbs - 2017 - unthsc-ir.tdl.orghttps://unthsc-ir.tdl.org/bitstream/handle/20.500.12503/29840/2017_05_gsbs_Gibbs_Lee_dissertation.pdf?sequence=1 Tissue-type plasminogen activator modulates macrophage M2 to M1 phenotypic change through annexin A2-mediated NF-κB pathway L Lin, K Hu - Oncotarget, 2017 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5675696/ Annexin II and regulation of cell surface fibrinolysis KA Hajjar, SS Acharya - Annals of the New York Academy of , 2000 - Wiley Online Libraryhttps://nyaspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1749-6632.2000.tb06321.x Annexin II: a mediator of the plasmin/plasminogen activator system KA Hajjar, S Krishnan - Trends in cardiovascular medicine, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1050173899000201 Tissue plasminogen activator binding to the annexin II tail domain: direct modulation by homocysteine KA Hajjar, L Mauri, AT Jacovina, F Zhong - Journal of Biological , 1998 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)46227-8/abstract Activation of Annexin A2 signaling at the blood-brain barrier in a mouse model of multiple sclerosis K Tezuka, M Suzuki, R Sato, S Kawarada - Journal of , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/jnc.15578 S-Homocysteinylated Proteins H Jakubowski , H Jakubowski - in Protein Structure/Function and Human , 2013 - Springerhttps://link.springer.com/chapter/10.1007/978-3-7091-1410-0_7 Coagulopathy in APL: a step forward? G Avvisati - Blood, The Journal of the American Society of , 2012 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/120/1/4/30117 Palladium-Mediated S-Arylation of Cysteine Residues with 4-[18F]Fluoroiodobenzene ([18F]FIB) F Francis , M Wuest, JD Woodfield - Bioconjugate , 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.bioconjchem.3c00522 Molecular and functional characterization of a Schistosoma bovis annexin: fibrinolytic and anticoagulant activity E de la Torre-Escudero, R Manzano-Roman - Veterinary , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304401711005589 Selective imaging of solid tumours via the calcium-dependent high-affinity binding of a cyclic octapeptide to phosphorylated Annexin A2 D Shen, B Xu, K Liang , R Tang , GP Sudlow - Nature biomedical , 2020 - nature.comhttps://www.nature.com/articles/s41551-020-0528-7 Higher expression of annexin A2 in metastatic bladder urothelial carcinoma promotes migration and invasion C Guo, R Trivedi , AK Tripathi , RR Nandy, DC Wagner - Cancers, 2022 - mdpi.comhttps://www.mdpi.com/2072-6694/14/22/5664 Annexin II: A Mediator of Cell Surface-Specific Plasmin Generation C Brownstein, DJ Falcone, A Jacovina - Annals of the New , 2001 - Wiley Online Libraryhttps://nyaspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1749-6632.2001.tb03937.x Homocysteine inhibits neoangiogenesis in mice through blockade of annexin A2-dependent fibrinolysis AT Jacovina, AB Deora, Q Ling - The Journal of , 2009 - Am Soc Clin Investighttps://www.jci.org/articles/view/39591 Targeted multifunctional lipid-PLGA hybrid nanosystems for metastatic breast cancer imaging and therapy AP Ranjan , A Mukerjee, JK Vishwanatha - Cancer Research, 2014 - AACRhttps://aacrjournals.org/cancerres/article/74/19_Supplement/4472/596459 An unusual treatment for a colonic polyp A Viscido, A Aratari , M Pimpo, V D'Ovidio, G Frieri - Gut, 2004 - gut.bmj.comhttps://gut.bmj.com/content/53/7/1000.extract

Pancreastatin is a peptide that is an inhibitor of potassium channels. Pancreastatin binds to and blocks the opening of K+ channels, thereby inhibiting the propagation of action potentials. Pancreastatin is a potent inhibitor of voltage-gated K+ channels in pancreatic β-cells and inhibits insulin secretion. Pancreastatin has been shown to inhibit the activity of sodium channels in the central nervous system, which may have therapeutic benefits for patients with epilepsy or other seizure disorders. Pancreastatin also has inhibitory effects on norepinephrine release from sympathetic nerves and acetylcholine release from parasympathetic nerves, which may be beneficial for patients with Parkinson's disease or Alzheimer's disease.

Peptide H-PSKPSFQEFVDWENVSPELNSTDQPFL-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PSKPSFQEFVDWENVSPELNSTDQPFL-cysteamide include the following: A coordinative dendrimer-based nanovaccine for cancer treatment Z Cao, L Ren, L Niu, R Zhao, N Liu, Q Zhuang, F Pan - Matter, 2023 - cell.comhttps://www.cell.com/matter/pdf/S2590-2385(23)00408-3.pdf A modular vaccine platform enabled by decoration of bacterial outer membrane vesicles with biotinylated antigens KB Weyant , A Oloyede , S Pal , J Liao - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41467-023-36101-2

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF121 antibody, catalog no. 70R-1778

Peptide H-NSPGLLVSPGNLNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NSPGLLVSPGNLNK^-OH include the following: High sensitivity quantitative proteomics using accumulated ion monitoring and automated multidimensional nano-flow chromatography P Cifani , A Kentsis - bioRxiv, 2017 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/128991.abstract

Consisting of the disulfide Bonds: Cys6- Cys22, Cys9-Cys12, Cys10- Cys18, and Cys13-Cys21 and of the trifluoroacetate salt form, this product can be used as an internal standard for Hepcidin assays.Hepcidin-24 is a peptide hormone that plays a key role in the regulation of iron metabolism in the body. It is produced by the liver and is secreted into the bloodstream, where it interacts with cells in the intestine and other tissues to control the absorption and distribution of iron. Hepcidin acts as a negative regulator of iron uptake and release by binding to and inhibiting the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. When hepcidin levels are high, ferroportin activity is reduced, leading to decreased iron absorption from the diet and reduced iron release from cells. When hepcidin-24 levels are low, ferroportin activity is increased, leading to increased iron absorption and release. Imbalances in hepcidin levels can lead to a variety of disorders, including iron-deficiency anemia, hemochromatosis (an iron overload disorder), and anemia of chronic disease. Therefore, hepcidin-24 is a key target for the development of treatments for these and other iron-related disorders. In addition to its role in iron metabolism, hepcidin has been shown to have antimicrobial properties, as it can inhibit the growth of certain bacteria and fungi. It may also be involved in the regulation of immune function and inflammation.

Oxytocin is a hormone that is produced in the hypothalamus and released by the pituitary gland. Oxytocin is a peptide consisting of nine amino acids, including two unusual ones: Cys (C) and Phe (F). This product has CAS number 2480-41-3. It is a reagent for use in chemical reactions, research chemicals, useful scaffold for synthetic chemistry, speciality chemical, versatile building block for synthetic chemistry, useful intermediate for synthetic chemistry, and useful building block for synthetic chemistry. It can be used as a fine chemical.

Please enquire for more information about H-Lys(Boc)-2-ClTrt-Resin (200-400 mesh) 1% DVB including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CSTB antibody, catalog no. 70R-2262

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ22167 antibody, catalog no. 70R-1787

A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA2 antibody, catalog no. 70R-1679

A synthetic peptide for use as a blocking control in assays to test for specificity of FEN1 antibody, catalog no. 70R-1605

A synthetic peptide for use as a blocking control in assays to test for specificity of STEAP3 antibody, catalog no. 70R-1771

Peptide H-TVAAPSVFIFPPSDEQL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TVAAPSVFIFPPSDEQL^K-OH include the following: Precise diagnosis and typing of early-stage renal immunoglobulin-derived amyloidosis by label-free quantification of parallel reaction monitoring-based targeted Y Li, Y Zhang, X Zhou, X Xue, M Wang, D Kang, Y Zhou - BMC nephrology, 2023 - Springerhttps://link.springer.com/article/10.1186/s12882-023-03105-5 Nano-scale liquid chromatography/mass spectrometry and on-the-fly orthogonal array optimization for quantification of therapeutic monoclonal antibodies and the X Duan, L Dai, SC Chen, JP Balthasar, J Qu - Journal of chromatography A, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967312008734 Generic Peptide Strategies for LC-MS/MS Bioanalysis of Human Monoclonal Antibody Drugs and Drug Candidates MT Furlong - : Accelerating Protein Biotherapeutics from Lab to , 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/9781119371779.ch13 Hybrid Ligand Binding Immunoaffinity-Liquid Chroma-tography/Mass Spectrometry for Biotherapeutics and M Yuan, OA Ismaiel , WRM Jr - 2019 - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/a57d/c39364ae847316dcdbc73959ae03331577fb.pdf Hybrid ligand binding immunoaffinity-liquid chromatography/mass spectrometry for biotherapeutics and biomarker quantitation: how to develop a hybrid LBA M Yuan, OA Ismaiel , WRJ Mylott - Rev , 2019 - betasciencepress-publishing.comhttps://betasciencepress-publishing.com/10-17145/fulltext/rss/hybrid-ligand-binding-immunoaffinity-liquid-chromatography-mass-spectrometry-for-biotherapeutics-and-biomarker-quantitation-how-to-develop-a-hybrid-lba-lc-ms-ms-method-for-a-protein/ General LC-MS/MS method approach to quantify therapeutic monoclonal antibodies using a common whole antibody internal standard with application to preclinical H Li, R Ortiz, L Tran, M Hall , C Spahr, K Walker - Analytical , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac202792n Human blood and bird egg proteins identified in red paint covering a 1000-year-old gold mask from Peru E Pires , LC Carvalho, I Shimada - Journal of Proteome , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.1c00472 Effects of calibration approaches on the accuracy for LC-MS targeted quantification of therapeutic protein E Nouri-Nigjeh, M Zhang, T Ji, H Yu, B An - Analytical , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac5001477 Anti-influenza activity of a Bacillus subtilis probiotic strain D Starosila, S Rybalko, L Varbanetz - Antimicrobial agents , 2017 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/aac.00539-17 Ultrasensitive disulfide scrambling analysis of mAbs by LC-MS with post-column reduction and glycine signal enhancement A Kleinberg, R Joseph, Y Mao, N Li - Analytical Biochemistry, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269722002299

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-Y^^TIAALLSPYS^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-Y^^TIAALLSPYS^^-OH include the following: Rational Manipulation of Amyloidogenesis Using an Atomic Level Map of Peptide-Fibril Interactions Y Liang, SZ Jasbi, S Morin, DJ Wilson - Biochemistry, 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi1007436 Functionalised amyloid fibrils for roles in cell adhesion SL Gras , AK Tickler, AM Squires , GL Devlin, MA Horton - Biomaterials, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961207009684 Microarrays of peptide fibrils created by electrostatically controlled deposition P Mesquida , DL Ammann, CE MacPhee - Advanced , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adma.200401229 Morphology and mechanical stability of amyloid-like peptide fibrils P Mesquida , CK Riener, CE MacPhee - Journal of Materials , 2007 - Springerhttps://link.springer.com/article/10.1007/s10856-006-0075-0 Possible Existence of alpha-Sheets in the Amyloid Fibrils Formed by a TTR105-115 Mutant MR Hilaire, B Ding , D Mukherjee - Journal of the American , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.7b09262 Lysine functionalised amyloid fibrils: the design and assembly of a TTR1-based peptide MN Bongiovanni , F Caruso , SL Gras - soft matter, 2013 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2013/sm/c3sm27244c 213 nm Ultraviolet photodissociation on peptide anions: radical-directed fragmentation patterns MA Halim , M Girod, L MacAleese - Journal of The , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-015-1297-5 Amyloid engineering-how terminal capping modifies morphology and secondary structure of supramolecular peptide aggregates M Grelich-Mucha , T Bachelart, V Torbeev - Biomaterials , 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2024/bm/d3bm01641b Autofluorescence of amyloids determined by enantiomeric composition of peptides M Grelich-Mucha , AM Garcia , V Torbeev - The Journal of , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jpcb.1c00808 The associative memory, water mediated, structure and energy model (AWSEM)-Amylometer: Predicting amyloid propensity and fibril topology using an optimized M Chen , NP Schafer , W Zheng - ACS chemical , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschemneuro.7b00436 Site-specific determination of TTR-related functional peptides by using scanning tunneling microscopy L Yu , Y Zheng, J Xu, F Qu , Y Lin, Y Zou, Y Yang - Nano Research, 2018 - Springerhttps://link.springer.com/article/10.1007/s12274-017-1825-7 Determination of orientations of aromatic groups in self-assembled peptide fibrils by polarised Raman spectroscopy JC Rodriguez-Perez, IW Hamley - Physical Chemistry , 2013 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2013/cp/c3cp52595c Constraints on the structure of fibrils formed by a racemic mixture of amyloid-beta peptides from solid-state NMR, electron microscopy, and theory JA Raskatov , AR Foley , JM Louis - Journal of the , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.1c06339 Initial Steps of Amyloidogenic Peptide Assembly Revealed by Cold-Ion Spectroscopy J Ujma , V Kopysov , NS Nagornova - Angewandte Chemie , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/anie.201710188 Self-assembly, bioactivity, and nanomaterials applications of peptide conjugates with bulky aromatic terminal groups IW Hamley - ACS Applied Bio Materials, 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsabm.2c01041 Protein aggregation and amyloidosis: confusion of the kinds? F Rousseau , J Schymkowitz , L Serrano - Current opinion in structural , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0959440X06000121 Biomimetic and Bioinspired Self-Assembled Peptide Nanostructures F Pampaloni , A Masotti - Biomimetic and Bioinspired , 2010 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=J2pKOLGonrsC&oi=fnd&pg=PA151&dq=(%22H-Y%5E%5ETIAALLSPYS%5E%5E-OH%22+OR+%22Y%5E%5ETIAALLSPYS%5E%5E%22+OR+%22NH2-Tyr%5E%5EThr-Ile-Ala-Ala-Leu-Leu-Ser-Pro-Tyr-Ser%5E%5E-OH%22+OR+%22H-YTIAALLSPYS-OH%22+OR+%22YTIAALLSPYS%22)+AND+peptide&ots=RU2bgonXIX&sig=CYWJrzECGZPyHAeBW2rOTJN5BTM Biomimetic and Bioinspired Self-Assembled Peptide Nanostructures F Pampaloni , A Masotti - Biomimetic and Bioinspired , 2010 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=J2pKOLGonrsC&oi=fnd&pg=PA151&dq=(%22H-Y%5E%5ETIAALLSPYS%5E%5E-OH%22+OR+%22Y%5E%5ETIAALLSPYS%5E%5E%22+OR+%22NH2-Tyr%5E%5EThr-Ile-Ala-Ala-Leu-Leu-Ser-Pro-Tyr-Ser%5E%5E-OH%22+OR+%22H-YTIAALLSPYS-OH%22+OR+%22YTIAALLSPYS%22)+AND+peptide&ots=RU2bgonYGX&sig=H80DVmLu5LVZ2K_oYaLLZGIEtZo Molecular conformation of a peptide fragment of transthyretin in an amyloid fibril CP Jaroniec , CE MacPhee , NS Astrof - Proceedings of the , 2002 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.252625999 Amyloid-like peptide aggregates C Kokotidou , P Tamamis , A Mitraki - 2020 - books.rsc.orghttps://books.rsc.org/books/edited-volume/852/chapter/601957

HBB MS Calibrator is a research tool that is used to calibrate mass spectrometry. It is an activator of Ligand and Receptor, which are proteins that play a role in cell biology. HBB MS Calibrator binds to ion channels and inhibits the opening of these channels. This leads to a decrease in the flow of ions through the channel, which can affect a number of cellular processes. HBB MS Calibrator also has pharmacological properties that are used for drug discovery and peptide production.

A synthetic peptide for use as a blocking control in assays to test for specificity of HAVCR2 antibody, catalog no. 70R-9687

Peptide H-KLVVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KLVVVGAGGVGK-OH include the following: Spatiotemporal changes in Ha-ras p21 expression through the hepatocyte cell cycle during liver regeneration YK Ng, G Taborn, I Ahmad, J Radosevich, K Bauer- Developmental ..., 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/001216069290247E Human T lymphocytes recognize a peptide of single point-mutated, oncogenic ras proteins. S Jung, HJ Schluesener - The Journal of experimental medicine, 1991 - rupress.orghttps://rupress.org/jem/article-abstract/173/1/273/24329

PSA1 141-150 acetate is used in the immunotherapy of cancer experiments that is a prostate specific antigen 1 peptide.

Peptide H-TWALPTYNNHLYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TWALPTYNNHLYK-OH include the following: Intact LC-MS analysis and peptide mapping of recombinant adeno associated virus (rAAV) capsid proteins H Liu, K Pohl, E Jones, Z Zhang - sciex.comhttps://sciex.com/content/dam/SCIEX/tech-notes/biopharma/ruo-mkt-02-14244-a/RUO-MKT-02-14244-B_AAV%20characterization%20CID%20EAD%207600_BE2.0.pdf

SARS-CoV is a coronavirus that causes SARS. This protein is the nucleocapsid protein of SARS-CoV and is encoded by the ORF2 gene. This protein is a component of the viral nucleocapsid, which contains the viral genomic RNA. Antibodies against this protein are used in serological tests to detect recent infection with SARS-CoV or SARS-CoV/SARS-CoV-2. COVID-19 (also known as 3C8) is an antibody that specifically binds to this protein and can be used as a diagnostic marker for SARS.

PACAP-38 (16-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of Tgfb1 antibody, catalog no. 20R-1135

Please enquire for more information about Thymosin β10 (human, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

APTSTAT3-9R acetate is a selective peptide binding STAT3 with antiproliferative and antitumor activity.

Peptide H-ASHLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ASHLGLAR-OH include the following: Isotope-coded N-terminal sulfonation of peptides allows quantitative proteomic analysis with increased de novo peptide sequencing capability YH Lee, H Han , SB Chang - Rapid communications in , 2004 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.1724 Protein cross-links: Universal isolation and characterization by isotopic derivatization and electrospray ionization mass spectrometry X Chen, YH Chen, VE Anderson - Analytical biochemistry, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269799942434 Sequence determination by MALDI-TOF mass spectrometry of an insecticidal lentil peptide of the PA1b type WG Taylor, DH Sutherland, H Zhang , DD Hegedus - Phytochemistry letters, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874390015000531 Highly selective and large scale mass spectrometric analysis of 4-hydroxynonenal modification via fluorous derivatization and fluorous solid-phase extraction W Yuan, Y Zhang, Y Xiong, T Tao, Y Wang - Analytical , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.6b04850 Improving de novo sequencing of peptides using a charged tag and C-terminal digestion W Chen, PJ Lee, H Shion, N Ellor - Analytical chemistry, 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac061670b Biochemistry and biology of anaphylatoxins TE Hugli - Complement, 1986 - karger.comhttps://karger.com/cod/article-abstract/3/3/111/69891 High-throughput comparative proteome analysis using a quantitative cysteinyl-peptide enrichment technology T Liu , WJ Qian , EF Strittmatter, DG Camp - Analytical , 2004 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac049485q A method for high-sensitivity peptide sequencing using postsource decay matrix-assisted laser desorption ionization mass spectrometry T Keough, RS Youngquist - Proceedings of the , 1999 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.96.13.7131 Solid-phase derivatization of tryptic peptides for rapid protein identification by matrix-assisted laser desorption/ionization mass spectrometry T Keough, MP Lacey - Rapid Communications in , 2002 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.670 Atmospheric pressure matrix-assisted laser desorption/ionization ion trap mass spectrometry of sulfonic acid derivatized tryptic peptides T Keough, MP Lacey, RJ Strife - Rapid Communications in , 2001 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.499 Dissociation mechanisms and implication for the presence of multiple conformations for peptide ions with arginine at the C-terminus: time-resolved photodissociation SH Yoon, JH Moon, MS Kim - Journal of mass spectrometry, 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.1773 Millisecond radiolytic modification of peptides by synchrotron X-rays identified by mass spectrometry SD Maleknia, M Brenowitz , MR Chance - Analytical chemistry, 1999 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac990500e De novo sequencing of peptides using selective 351 nm ultraviolet photodissociation mass spectrometry SA Robotham, C Kluwe, JR Cannon - Analytical , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac402309h Evidence that the receptor for C4a is distinct from the C3a receptor RS Ames, MA Tometta, JJ Foley, TE Hugli - , 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0162310997000799 Design and biological activity of a new generation of synthetic C3a analogues by combination of peptidic and non-peptidic elements. R Gerardy-Schahn, D Ambrosius, M Casaretto - Biochemical , 1988 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC1135211/ Enhancement of ultraviolet photodissociation efficiencies through attachment of aromatic chromophores L Vasicek, JS Brodbelt - Analytical chemistry, 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac102126s Induction of complement C3a receptor responses by kallikrein-related peptidase 14 K Oikonomopoulou, RA DeAngelis, H Chen - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/191/7/3858/39956 Photodissociation tandem mass spectrometry at 266 nm of an aliphatic peptide derivatized with phenyl isothiocyanate and 4-sulfophenyl isothiocyanate JY Oh, JH Moon, YH Lee, SW Hyung - Journal Devoted to , 2005 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.1922 facile fragmentation pathway of gas-phase peptide ions: a study on the gas-phase fragmentation mechanism and energetics of tryptic peptides modified with 4 JW Shin, YH Lee, S Hwang - Journal of mass , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.1172 C-terminal de novo sequencing of peptides using oxazolone-based derivatization with bromine signature JS Kim , M Shin, JS Song, S An, HJ Kim - Analytical biochemistry, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269711005318 Matrix-assisted laser desorption/ionization signal enhancement of peptides by picolinamidination of amino groups JS Kim , JH Kim, HJ Kim - to the Rapid Dissemination of Up-to , 2008 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3392 Simplifying fragmentation patterns of multiply charged peptides by N-terminal derivatization and electron transfer collision activated dissociation JA Madsen , JS Brodbelt - Analytical chemistry, 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac9000942 On-tissue N-terminal peptide derivatizations for enhancing protein identification in MALDI mass spectrometric imaging strategies J Franck , M El Ayed, M Wisztorski , M Salzet - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac901043n Collision induced decomposition of peptides. Choice of collision parameters I Haller, UA Mirza, BT Chait - Journal of the American Society for Mass , 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/1044030596856133 Enhanced electron transfer dissociation of peptides modified at C-terminus with fixed charges BJ Ko , JS Brodbelt - Journal of The American Society for Mass , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-012-0458-z Ultraviolet photodissociation of carboxylate-derivatized peptides in a quadrupole ion trap BJ Ko , JS Brodbelt - Journal of The American Society for Mass , 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-010-0016-5

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of Sec31a antibody, catalog no. 70R-9307

Peptide H-IQNILTEEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IQNILTEEPK-OH include the following: Identification a novel clinical biomarker in early diagnosis of human non-small cell lung cancer Y Jin, Y Yang, Y Su, X Ye, W Liu, Q Yang, J Wang - Glycoconjugate , 2019 - Springerhttps://link.springer.com/article/10.1007/s10719-018-09853-z Multidimensional protein identification technology-selected reaction monitoring improving detection and quantification for protein biomarker studies C Krisp, MJ McKay , DA Wolters , MP Molloy - Analytical chemistry, 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac2028485 Proteomic profiling of exudates from diabetic foot ulcers and acute wounds using mass spectrometry C Krisp - 2022 - figshare.mq.edu.auhttps://figshare.mq.edu.au/ndownloader/files/34526789 Targeted quantitation of CVD-linked plasma proteins for biomarker verification and validation AJ Percy , S Byrns, AG Chambers - Expert Review of , 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1586/14789450.2013.856763 Protocol for standardizing high-to-moderate abundance protein biomarker assessments through an MRM-with-standard-peptides quantitative approach AJ Percy , J Yang, AG Chambers, Y Mohammed - , Analysis and Practical , 2016 - Springerhttps://link.springer.com/chapter/10.1007/978-3-319-41448-5_24 Multiplexed MRM-based quantitation of candidate cancer biomarker proteins in undepleted and non-enriched human plasma AJ Percy , AG Chambers, J Yang, CH Borchers - Proteomics, 2013 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201200316

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP24A1 antibody, catalog no. 70R-9999

A synthetic peptide for use as a blocking control in assays to test for specificity of Rab23 antibody, catalog no. 70R-9451

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF668 antibody, catalog no. 20R-1224

A synthetic peptide for use as a blocking control in assays to test for specificity of Tdp1 antibody, catalog no. 70R-9482

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2N antibody, catalog no. 70R-1147

OVA 257 264 peptide (SIINFEKL) conjugated to KLH Ovalbumin protein Ovalbumin (Uniprot P01012) is the major component of egg white. It has been demonstrated that Ovalbumin contains B-cell epitopes which are recognized by specific IgE antibodies and CD4 T cell epitopes restricted by the MHC I-Ad molecule in mice and by HLA-D molecule in human such as OVA(257-264). Applications of OVA 257-264 OVA 257-264 is used to stimulate T cells in PBMCs and to quantify peptide epitope specificity and IFN-γ releasing effector cells by ELISPOT assay. OVA 257-264 is also used to test new adjuvant in immunotherapeutic vaccine development. OVA 257-264 can form a stable hydrogel and stimulate a immune response. This reaction seems to be linked with OVA 257-264 property to self-assemble into a hydrogel. OVA 257-264 KLH conjugate Keyhole limpet hemocyanin (KLH) is a carrier protein which enhances immune response against haptens conjugated to it. SB-PEPTIDE has a long experience in haptens / carrier proteins conjugations and offers here OVA257-264 conjugated to KLH to elicit specific antibodies anti-SIINFEKL. SB-PEPTIDE offers several versions of OVA257-264 including a scrambled version, a biotionylated version and a BSA-conjuagted version.

Peptide H-LLSLTYDQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLSLTYDQK-OH include the following: Degradation of polysorbate 20 by sialate O-acetylesterase in monoclonal antibody formulations S Zhang , H Xiao, N Li - Journal of Pharmaceutical Sciences, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022354921004706

Peptide H-SVSSFERFEIFPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SVSSFERFEIFPK-OH include the following: Towards identification of the mechanisms of action of parasite-derived peptide GK1 on the immunogenicity of an influenza vaccine R Segura-Velazquez, G Fragoso, E Sciutto - Clinical and Vaccine , 2009 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/cvi.00106-09 DNA Vaccines Encoding Antigen Targeted to MHC Class II Induce Influenza-Specific CD8+ T Cell Responses, Enabling Faster Resolution of Influenza Disease L Lambert, E Kinnear, JU McDonald - Frontiers in , 2016 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2016.00321/full Two MHC class II-restricted epitopes are processed in distinct endocytic compartments as a result of the acid-induced structural changes in a viral KA Chianese-Bullock - 1998 - search.proquest.comhttps://search.proquest.com/openview/a9b134cc3b0f5c07c3f56cfb0ae6bfc8/1?pq-origsite=gscholar&cbl=18750&diss=y Adjuvant effects of formalin-inactivated HSV through activation of dendritic cells and inactivation of myeloid-derived suppressor cells in cancer immunotherapy K Ohkusu-Tsukada, S Ohta - journal of cancer, 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.25319 Enforced expression of Spi-B reverses T lineage commitment and blocks beta-selection JM Lefebvre, MC Haks, MO Carleton - The Journal of , 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/174/10/6184/36594 Peripheral T cell survival requires continual ligation of the T cell receptor to major histocompatibility complex-encoded molecules J Kirberg, A Berns, H Boehmer - The Journal of experimental medicine, 1997 - rupress.orghttps://rupress.org/jem/article-abstract/186/8/1269/7316 The specificity of targeted vaccines for APC surface molecules influences the immune response phenotype G Grodeland, S Mjaaland , G Tunheim, AB Fredriksen - PloS one, 2013 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0080008 Active suppression induced by repetitive self-epitopes protects against EAE development F Puentes, K Dickhaut, M Hofstatter, K Falk - PLoS , 2013 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0064888 Vaccine molecules targeting Xcr1 on cross-presenting DCs induce protective CD8+ T-cell responses against influenza virus E Fossum , G Grodeland, D Terhorst - European journal of , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201445080 Induction of autoreactive regulatory T cells through promiscuous gene expression by bone marrow-resident plasma cells CY Chen - 2019 - archiv.ub.uni-heidelberg.dehttps://archiv.ub.uni-heidelberg.de/volltextserver/25331/ Virus-mimetic polymer nanoparticles displaying hemagglutinin as an adjuvant-free influenza vaccine C Lee, J Jeong, T Lee , W Zhang, L Xu, JE Choi - Biomaterials, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961218305908 Epitope-targeted cytotoxic T cells mediate lineage-specific antitumor efficacy induced by the cancer mucosa antigen GUCY2C AE Snook , MS Magee, GP Marszalowicz - Cancer Immunology , 2012 - Springerhttps://link.springer.com/article/10.1007/s00262-011-1133-0 Intranasal delivery of a cDC1 targeted influenza vaccine with poly (I: C) enhances T cell responses and protects against influenza infection A Lysen, A Gudjonsson, DY Tesfaye - Scandinavian , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/sji.13128

Peptide H-IYLYTLNDNAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IYLYTLNDNAR-OH include the following: Analysis of protein chlorination by mass spectrometry T Nybo, MJ Davies , A Rogowska-Wrzesinska - Redox Biology, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2213231719303179 Chlorination and oxidation of human plasma fibronectin by myeloperoxidase-derived oxidants, and its consequences for smooth muscle cell function T Nybo, H Cai , CY Chuang , LF Gamon - Redox Biology, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S221323171830675X Quantitation of 87 proteins by nLC-MRM/MS in human plasma: workflow for large-scale analysis of biobank samples M Rezeli , K Sjödin, H Lindberg - Journal of proteome , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.7b00235

A synthetic peptide for use as a blocking control in assays to test for specificity of POLR2B antibody, catalog no. 70R-7925

Peptide Vasoactive Intestinal peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Vasoactive Intestinal peptide include the following: Colonic vasoactive intestinal peptide nerves in inflammatory bowel disease Y Kubota, RE Petras, CA Ottaway, RR Tubbs - Gastroenterology, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0016508592700198 Therapeutic potential of vasoactive intestinal peptide and its receptor VPAC2 in type 2 diabetes X Hou, D Yang, G Yang, M Li, J Zhang - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fendo.2022.984198/full Role of vasoactive intestinal peptide in osteoarthritis W Jiang, H Wang, Y Li, W Luo - Journal of Biomedical Science, 2016 - Springerhttps://link.springer.com/article/10.1186/s12929-016-0280-1 Vasoactive intestinal peptide ameliorates intestinal barrier disruption associated with Citrobacter rodentium-induced colitis VS Conlin, X Wu, C Nguyen , C Dai - American Journal , 2009 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpgi.90551.2008 Vasoactive intestinal peptide as a new drug for treatment of primary pulmonary hypertension V Petkov, W Mosgoeller, R Ziesche - The Journal of , 2003 - Am Soc Clin Investighttps://www.jci.org/articles/view/17500 Osteotropic effects by the neuropeptides calcitonin gene-related peptide, substance P and vasoactive intestinal peptide UH Lerner, E Persson - J Musculoskelet Neuronal Interact, 2008 - researchgate.nethttps://www.researchgate.net/profile/Emma-Persson/publication/5230610_Osteotropic_effects_by_the_neuropeptides_calcitonin_gene-related_peptide_substance_P_and_vasoactive_intestinal_peptide/links/0c96052ab06b43037b000000/Osteotropic-effects-by-the-neuropeptides-calcitonin-gene-related-peptide-substance-P-and-vasoactive-intestinal-peptide.pdf Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor SP Sreedharan, DR Patel, JX Huang - and biophysical research , 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X8371658X Catalytic hydrolysis of vasoactive intestinal peptide by human autoantibody S Paul , DJ Volle, CM Beach, DR Johnson, MJ Powell - Science, 1989 - science.orghttps://www.science.org/doi/abs/10.1126/science.2727702 Vasoactive Intestinal Peptide-Secreting Tumors: A Review PK Siddappa , SS Vege - Pancreas, 2019 - journals.lww.comhttps://journals.lww.com/pancreasjournal/fulltext/2019/10000/vasoactive_intestinal_peptide_secreting_tumors__a.2.aspx Identification of Key Residues for Interaction of Vasoactive Intestinal Peptide with Human VPAC1 and VPAC2Receptors and Development of a Highly Selective P Nicole, L Lins , C Rouyer-Fessard, C Drouot - Journal of Biological , 2000 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)66072-2/abstract Vasoactive intestinal peptide modulates proinflammatory mediator synthesis in osteoarthritic and rheumatoid synovial cells MG Juarranz , B Santiago, M Torroba - , 2004 - academic.oup.comhttps://academic.oup.com/rheumatology/article-abstract/43/4/416/1784552 Vasoactive Intestinal Peptide with Isolated Intestinal Epithelial Cells from Rat: 2. Characterization and Structural Requirements of the Stimulatory Effect of Vasoactive M Laburthe, JC Prieto, B Amiranoff - European journal of , 1979 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1432-1033.1979.tb13034.x Vasoactive intestinal peptide regulates its receptor expression and functions of human keratinocytes via type I vasoactive intestinal peptide receptors M Kakurai, S Murata, H Nakagawa, N Fujita - Journal of investigative , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022202X15412333 The neuropeptide vasoactive intestinal peptide generates tolerogenic dendritic cells M Delgado , E Gonzalez-Rey - The Journal of Immunology, 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/175/11/7311/36901 The significance of vasoactive intestinal peptide in immunomodulation M Delgado , D Pozo , D Ganea - Pharmacological reviews, 2004 - ASPEThttps://pharmrev.aspetjournals.org/content/56/2/249.short Cutting edge: is vasoactive intestinal peptide a type 2 cytokine? M Delgado , D Ganea - The Journal of Immunology, 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/166/5/2907/34621 Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions M Delgado , D Ganea - Amino acids, 2013 - Springerhttps://link.springer.com/article/10.1007/s00726-011-1184-8 Vasoactive intestinal peptide in the immune system: potential therapeutic role in inflammatory and autoimmune diseases M Delgado , C Abad, C Martinez , M Juarranz - Journal of molecular , 2002 - Springerhttps://link.springer.com/article/10.1007/s00109-001-0291-5 Vasoactive intestinal peptide prevents experimental arthritis by downregulating both autoimmune and inflammatory components of the disease M Delgado , C Abad, C Martinez , J Leceta - Nature medicine, 2001 - nature.comhttps://www.nature.com/articles/nm0501_563 Vasoactive intestinal peptide generates CD4+CD25+ regulatory T cells in vivo M Delgado , A Chorny , E Gonzalez-Rey - Journal of leukocyte , 2005 - academic.oup.comhttps://academic.oup.com/jleukbio/article-abstract/78/6/1327/6922715 Interaction of vasoactive intestinal peptide with isolated intestinal epithelial cells from rat: 1. Characterization, quantitative aspects and structural requirements of JC Prieto, M Laburthe - European Journal of , 1979 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1432-1033.1979.tb13033.x Therapeutic efficacy of stable analogues of vasoactive intestinal peptide against pathogens J Campos-Salinas, A Cavazzuti, F O'Valle - Journal of Biological , 2014 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)38663-4/abstract The effects of vasoactive intestinal peptide in neurodegenerative disorders G Deng, L Jin - Neurological research, 2017 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/01616412.2016.1250458 Pituitary adenylate cyclase activating peptide: a novel vasoactive intestinal peptide-like neuropeptide in the gut F Sundler, E Ekblad, A Absood, R Haca¥kanson, K Köves - Neuroscience, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0306452292900649 The VIP2 receptor: Molecular characterisation of a cDNA encoding a novel receptor for vasoactive intestinal peptide EM Lutz, WJ Sheward, KM West, JA Morrow - FEBS , 1993 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1016/0014-5793(93)81668-P Vasoactive intestinal peptide generates human tolerogenic dendritic cells that induce CD4 and CD8 regulatory T cells E Gonzalez-Rey , A Chorny , A Fernandez-Martin - Blood, 2006 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/107/9/3632/133492 Effect of acetylcholine and vasoactive intestinal peptide on cerebral blood flow DD Heistad, ML Marcus, SI Said - American Journal of , 1980 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpheart.1980.239.1.h73 Immunobiology of vasoactive intestinal peptide (VIP) D Pozo , M Delgado , C Martı́nez , JM Guerrero , J Leceta - Immunology today, 2000 - cell.comhttps://www.cell.com/trends/immunology/fulltext/S0167-5699(99)01525-X Therapeutic potential of vasoactive intestinal peptide and its receptors in neurological disorders CM White, S Ji , H Cai , S Maudsley - CNS & Neurological , 2010 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cnsnddt/2010/00000009/00000005/art00014 Therapeutic effects of vasoactive intestinal peptide in the trinitrobenzene sulfonic acid mice model of Crohn's disease C Abad, C Martinez , MG Juarranz , A Arranz , J Leceta - Gastroenterology, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0016508503000556 Pharmacology and functions of receptors for vasoactive intestinal peptide and pituitary adenylate cyclase-activating polypeptide: IUPHAR review 1 AJ Harmar , J Fahrenkrug, I Gozes - British journal of , 2012 - Wiley Online Libraryhttps://bpspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1476-5381.2012.01871.x Vasoactive intestinal peptide causes marked cephalic vasodilation, but does not induce migraine A Rahmann, T Wienecke, JM Hansen - , 2008 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1111/j.1468-2982.2007.01497.x Inhaled vasoactive intestinal peptide exerts immunoregulatory effects in sarcoidosis A Prasse , G Zissel , N Lutzen, J Schupp - American journal of , 2010 - atsjournals.orghttps://www.atsjournals.org/doi/abs/10.1164/rccm.200909-1451OC Vasoactive intestinal peptide induces regulatory dendritic cells with therapeutic effects on autoimmune disorders A Chorny , E Gonzalez-Rey - Proceedings of the , 2005 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0504484102 Glucagon-like peptide-2 relaxes mouse stomach through vasoactive intestinal peptide release A Amato, S Baldassano , R Serio - American Journal of , 2009 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpgi.90587.2008

A synthetic peptide for use as a blocking control in assays to test for specificity of JMJD5 antibody, catalog no. 70R-9587

A synthetic peptide for use as a blocking control in assays to test for specificity of COTL1 antibody, catalog no. 70R-2639

Please enquire for more information about Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-SGRGKGGKGLGKGGAKRHRKVLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SGRGKGGKGLGKGGAKRHRKVLR-NH2 include the following: Tau stabilizes chromatin compaction T Rico, M Gilles, A Chauderlier, T Comptdaer - Frontiers in cell and , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fcell.2021.740550/full A rapid and sensitive assay for histone acetyl-transferase activity S Ait-Si-Ali, S Ramirez, P Robin, D Trouche - Nucleic acids , 1998 - academic.oup.comhttps://academic.oup.com/nar/article-abstract/26/16/3869/1023225 Global proteome quantification for discovering imatinib-induced perturbation of multiple biological pathways in K562 human chronic myeloid leukemia cells L Xiong, J Zhang , B Yuan , X Dong - Journal of proteome , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr100814y Formaldehyde-Induced Histone Modifications in Vitro K Lu , G Boysen , L Gao, LB Collins - Chemical research in , 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/tx8000576 Concomitant increase of histone acetyltransferase activity and degradation of p300 during retinoic acid-induced differentiation of F9 cells F Brouillard, CE Cremisi - Journal of Biological Chemistry, 2003 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)82995-0/abstract Down-regulation of p300/CBP histone acetyltransferase activates a senescence checkpoint in human melanocytes D Bandyopadhyay, NA Okan , E Bales, L Nascimento - Cancer research, 2002 - AACRhttps://aacrjournals.org/cancerres/article-abstract/62/21/6231/509372 Preparation and biochemical analysis of classical histone deacetylases A Villagra , E Sahakian , E Seto - Methods in enzymology, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S007668791630009X

A synthetic peptide for use as a blocking control in assays to test for specificity of EDC4 antibody, catalog no. 70R-4230

Peptide H-VYVEELKPTPEGDLEILLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYVEELKPTPEGDLEILLQK^-OH include the following: Glycation of beta-lactoglobulin combined by sonication pretreatment reduce its allergenic potential YH Shao, Y Zhang, M Zhu, J Liu , Z Tu - International Journal of Biological , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0141813020339842 Digestibility of polymerized whey protein using in vitro digestion model and antioxidative property of its hydrolysate W Zhong, J Li, J Dai, C Wang, T Zhang - Food Bioscience, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212429221002340 Antibody-free, targeted mass-spectrometric approach for quantification of proteins at low picogram per milliliter levels in human plasma/serum T Shi , TL Fillmore, X Sun, R Zhao - Proceedings of the , 2012 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1204366109 Comparative Study of in Situ and ex Situ Enzymatic Hydrolysis of Milk Protein and Separation of Bioactive Peptides in an Electromembrane Reactor S Suwal , E Rozoy, M Manenda, A Doyen - ACS Sustainable , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acssuschemeng.7b00651 Use of redundancy analysis and multivariate regression models to select the significant membrane properties affecting peptide migration during electrodialysis with S Kadel , M Persico, J Thibodeau, C Laine - Separation and , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1383586618336785 How physicochemical properties of filtration membranes impact peptide migration and selectivity during electrodialysis with filtration membranes: Development of S Kadel , G Daigle , J Thibodeau, V Perreault - Journal of membrane , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0376738820307535 Deciphering the competitive binding interaction of beta-lactoglobulin with benzaldehyde and vanillic acid via high-spatial-resolution multi-spectroscopic R Zhang, W Jia - Food Hydrocolloids, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0268005X23002709 High-performance thin-layer chromatography-immunostaining as a technique for the characterization of whey protein enrichment in edam cheese M Treblin, T von Oesen, J Luneburg - Foods, 2022 - mdpi.comhttps://www.mdpi.com/2304-8158/11/4/534 Reference LC-MS/MS method to detect fresh cheeses adulteration with whey LVA de Oliveira, CR Kleemann, L Molognoni - Food Research , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0963996922001971 Detection of milk powder in liquid whole milk using hydrolyzed peptide and intact protein mass spectral fingerprints coupled with data fusion technologies L Du, W Lu, Y Zhang, B Gao , L Yu - Food Science & Nutrition, 2020 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/fsn3.1430 Impact of UV-C pretreatment on beta-lactoglobulin hydrolysis by trypsin: Production and bioavailability of bioactive peptides KN Cavalcante, JF Feitor , STB Morais , RT Nassu - International Dairy , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0958694623000699 An approach to correlate tandem mass spectral data of peptides with amino acid sequences in a protein database JK Eng , AL McCormack, JR Yates - Journal of the american , 1994 - ACS Publicationshttps://pubs.acs.org/doi/full/10.1016/1044-0305(94)80016-2 An approach to correlate tandem mass spectral data of peptides with amino acid. J Eng , A McCormack, J Yatesaca¢ - Society for Mass Spectrometry, 1994 - academia.eduhttps://www.academia.edu/download/55364255/1044-0305_2894_2980016-220171223-28498-mrx26m.pdf Anti-allergen antibodies can be neutralized by antibodies obtained against a peptide complementary to the allergen: towards a new peptide therapy for allergy I Selo, C Creminon, J Grassi, JY Couraud - Immunology letters, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165247801003194 Purification and fractionation of bioactive peptides through membrane filtration: A critical and application review F Alavi , ON Ciftci - Trends in Food Science & Technology, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S092422442200468X Separation and enrichment of antioxidant peptides from whey protein isolate hydrolysate by aqueous two-phase extraction and aqueous two-phase flotation B Jiang, J Na, L Wang, D Li, C Liu, Z Feng - Foods, 2019 - mdpi.comhttps://www.mdpi.com/2304-8158/8/1/34 A statistical model for identifying proteins by tandem mass spectrometry AI Nesvizhskii , A Keller, E Kolker - Analytical , 2003 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac0341261

A synthetic peptide for use as a blocking control in assays to test for specificity of STAT6 antibody, catalog no. 70R-7858

Peptide H-AITEVECFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AITEVECFL-OH include the following: Interplay of cellular and humoral immune responses against BK virus in kidney transplant recipients with polyomavirus nephropathy Y Chen, J Trofe , J Gordon , RA Du Pasquier - Journal of , 2006 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.80.7.3495-3505.2006 Functional Characterization of BK Virus-Specific CD4+ T Cells with Cytotoxic Potential in Seropositive Adults W Zhou, M Sharma, J Martinez, T Srivastava - Viral , 2007 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2007.0030 Cross-Reactivity of T Lymphocytes VVP Polypeptides - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=eb714bcaeeae48fa573f786f9d5d10b78a6a7a23 Cross-reactive CTL recognizing two HLA-A* 02-restricted epitopes within the BK virus and JC virus VP1 polypeptides are frequent in immunocompetent MC Sharma, W Zhou, J Martinez, L Krymskaya - Virology, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682206001413 Cross-reactivity of T lymphocytes recognizing a human cytotoxic T-lymphocyte epitope within BK and JC virus VP1 polypeptides L Krymskaya, MC Sharma, J Martinez, W Haq - Journal of , 2005 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.79.17.11170-11178.2005 T-cell responses to peptide fragments of the BK virus T antigen: implications for cross-reactivity of immune response to JC virus J Li, J Melenhorst, N Hensel - Journal of General , 2006 - microbiologyresearch.orghttps://www.microbiologyresearch.org/content/journal/jgv/10.1099/vir.0.82094-0

A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 70R-8548

A synthetic peptide for use as a blocking control in assays to test for specificity of P2rx2 antibody, catalog no. 70R-8075

Peptide H-KAVYNFATM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KAVYNFATM-OH include the following: DetailedAnalysis of the CD8+ T-Cell Response followingAdenovirusVaccination TC Yang, K Dayball, YH Wan , J Bramson - Journal of virology, 2003 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.77.24.13407-13411.2003 A Structural Basis for CD8+ T Cell-dependent Recognition of Non-homologous Peptide Ligands T Sandalova , J Michaaca«lsson , RA Harris , J Odeberg - 2005 - academia.eduhttps://www.academia.edu/download/72285277/27069.full.pdf Structural bases underlying re-established recognition of a viral immune escape variant T Sandalova , E Allerbring, AD Duru , R Sun - Immunome , 2017 - search.proquest.comhttps://search.proquest.com/openview/6e4e590dd1285396ffb77ca351869b08/1?pq-origsite=gscholar&cbl=54870 Memory CD8+ T cells require CD8 coreceptor engagement for calcium mobilization and proliferation, but not cytokine production SE Kerry, R Maile , EJ Collins, JA Frelinger - Immunology, 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2567.2004.02070.x CpG-DNA activates in vivo T cell epitope presenting dendritic cells to trigger protective antiviral cytotoxic T cell responses RM Vabulas, H Pircher , GB Lipford - The Journal of , 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/164/5/2372/69663 T cells down-modulate peptide-MHC complexes on APCs in vivo RM Kedl , BC Schaefer , JW Kappler, P Marrack - Nature immunology, 2002 - nature.comhttps://www.nature.com/articles/ni742 Binding of H-2Kb-specific Peptides to TAP and Major Histocompatibility Complex Class I in Microsomes from Wild-type, TAP1, and beta2-Microglobulin Mutant Mice P Wang , C Raynoschek, K Svensson - Journal of Biological , 1996 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)40080-4/abstract Rapid destruction of the tumor microenvironment by CTLs recognizing cancer-specific antigens cross-presented by stromal cells MT Spiotto, H Schreiber - Cancer immunity, 2005 - AACRhttps://aacrjournals.org/cancerimmun/article-abstract/5/1/8/472010 In Vivo Selection of a Lymphocytic Choriomeningitis Virus Variant That Affects Recognition of the GP33-43 Epitope by H-2Db but Not H-2Kb MT Puglielli, AJ Zajac, RG van der Most - Journal of , 2001 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.75.11.5099-5107.2001 Encapsulation of lipopeptides within liposomes: effect of number of lipid chains, chain length and method of liposome preparation MT Liang, NM Davies, I Toth - International journal of pharmaceutics, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378517305004114 Intrathymic deletion of MHC class I-restricted cytotoxic T cell precursors by constitutive cross-presentation of exogenous antigen M Merkenschlager , MO Power - European journal of , 1999 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1521-4141(199905)29:05%3C1477::AID-IMMU1477%3E3.0.CO;2-3 Antigen presentation by exosomes released from peptide-pulsed dendritic cells is not suppressed by the presence of active CTL L Luketic, J Delanghe, PT Sobol, P Yang - The Journal of , 2007 - journals.aai.orghttps://journals.aai.org/jimmunol/article/179/8/5024/111573 In vivo generation of cytotoxic T cells from epitopes displayed on peptide-based delivery vehicles KS Kawamura, RC Su , LT Nguyen - The Journal of , 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/168/11/5709/34240 Increased adjuvant activity of minimal CD8 T cell peptides incorporated into lipid-core-peptides K White, P Kearns, I Toth , S Hook - Immunology and cell , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.0818-9641.2004.01269.x Antigen Presentation by Exosomes Released J Bramson , Y Wan , EF Yang, KL Mossman , J Gauldie - J Immunol, 2007 - researchgate.nethttps://www.researchgate.net/profile/Jack-Gauldie/publication/5932590_Antigen_Presentation_by_Exosomes_Released_from_Peptide-Pulsed_Dendritic_Cells_Is_not_Suppressed_by_the_Presence_of_Active_CTL/links/56e2d70108ae387a2483a26f/Antigen-Presentation-by-Exosomes-Released-from-Peptide-Pulsed-Dendritic-Cells-Is-not-Suppressed-by-the-Presence-of-Active-CTL.pdf The MHC class I cancer-associated neoepitope Trh4 linked with impaired peptide processing induces a unique noncanonical TCR conformer I Hafstrand, EM Doorduijn, AD Duru - The Journal of , 2016 - journals.aai.orghttps://journals.aai.org/jimmunol/article/196/5/2327/102372 Effective antitumor peptide vaccines can induce severe autoimmune pathology H Sultan , J Trillo-Tinoco, P Rodriguez , E Celis - Oncotarget, 2017 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5642557/ T cell receptor sharing by cytotoxic T lymphocytes facilitates efficient virus control G Chaudhri, BJ Quah, Y Wang - Proceedings of the , 2009 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0906554106 Dendritic cell (DC) dependent and DC independent generation of specific CD8+ T cell responses to MHC class I anchoring peptides. F Zipprich, S Wirth-Dulex, A Hugin - Journal of Investigative , 1997 - infona.plhttps://www.infona.pl/resource/bwmeta1.element.elsevier-45e8cbd2-5924-3c19-a5db-15bde8aed180 in the Immunodominant LCMV-Derived Epitope gp33 Highlights the Sensitivity of the TCR Recognition Mechanism for the MHC/Peptide Structure and Dynamics F Ballabio , L Broggini , C Paissoni , X Han, K Peqini - ACS , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsomega.1c06964 Conformational analysis and rational design of tumor-associated altered peptide ligands F Ballabio , C Paissoni , C Camilloni - bioscienzebio.unimi.ithttps://bioscienzebio.unimi.it/phd/poster_file/2019-06-26_federico_ballabio.pdf 2D kinetic analysis of TCR and CD8 coreceptor for LCMV GP33 epitopes EM Kolawole , R Andargachew, B Liu - Frontiers in , 2018 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2018.02348/full Unexpected T-cell recognition of an altered peptide ligand is driven by reversed thermodynamics EB Allerbring, AD Duru , H Uchtenhagen - European journal of , 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201242588 Mature T cell reactivity altered by peptide agonist that induces positive selection. E Sebzda, TM Kundig, CT Thomson, K Aoki - The Journal of , 1996 - rupress.orghttps://rupress.org/jem/article-abstract/183/3/1093/47878 T cell immunity after a viral infection versus T cell tolerance induced by soluble viral peptides D Kyburz , P Aichele, DE Speiser - European journal of , 1993 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830230834 Protection against lymphocytic choriomeningitis virus infection induced by a reduced peptide bond analogue of the H-2Db-restricted CD8+ T cell epitope GP33 C Stemmer, A Quesnel, A Prevost-Blondel - Journal of Biological , 1999 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)87693-7/abstract Cross-presentation of virus-like particles by skin-derived CD8- dendritic cells: a dispensable role for TAP C Ruedl , T Storni, F Lechner, T Bachi - European journal of , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1521-4141(200203)32:3%3C818::AID-IMMU818%3E3.0.CO;2-U A structural basis for LCMV immune evasion: subversion of H-2Db and H-2Kb presentation of gp33 revealed by comparative crystal structure analyses A Achour , J Michaaca«lsson , RA Harris , J Odeberg - Immunity, 2002 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(02)00478-8.pdf

Peptide H-DSALGFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSALGFLR^-OH include the following: Selection of possible signature peptides for the detection of bovine lactoferrin in infant formulas by LC-MS/MS M Yuan, C Feng, S Wang, W Zhang, M Chen, H Jiang - Plos one, 2017 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0184152

Peptide H-HEDIISLWDQSLKPC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HEDIISLWDQSLKPC-OH include the following: Anti-HIV type 1 properties of chemically modified heparins with diminished anticoagulant activity L LOPALCO, F CICCOMASCOLO, P LANZA - AIDS research and , 1994 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.1994.10.787 Direct interaction of complement factor H with the C1 domain of HIV type 1 glycoprotein 120 C PINTaca‰R, AG SICCARDI , R LONGHI - AIDS research and , 1995 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.1995.11.577

A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1G2 antibody, catalog no. 70R-3658

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX55 antibody, catalog no. 70R-4786

A synthetic peptide for use as a blocking control in assays to test for specificity of ECT2 antibody, catalog no. 70R-5714

Peptide H-GLVPFLVSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLVPFLVSV-OH include the following: Unusual viral ligand with alternative interactions is presented by HLA-Cw4 in human respiratory syncytial virus-infected cells S Infantes, E Lorente , JJ Cragnolini - and Cell Biology, 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1038/icb.2010.125 Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells E Lorente , S Infantes, E Barnea, I Beer - Journal of , 2012 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.05737-11 TAP-independent human histocompatibility complex-Cw1 antigen processing of an HIV envelope protein conserved peptide E Lorente , S Infantes, E Barnea, I Beer, R Garcia - AIDS, 2011 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/2011/01140/TAP_independent_human_histocompatibility.18.aspx

Highly specific protein tag that can be added to a protein using recombinant DNA technology. FLAG is an artificial antigen to which high affinity monoclonal antibodies have been raised, therefore allowing for highly effective protein purification by affinity chromatography as well as accurate localisation of FLAG tagged proteins within living cells, or Western blots. FLAG peptide can be used to effectively purify complexes with multiple proteins as its mild purification procedure tends not to disrupt such complexes. It can be used to obtain proteins of sufficient purity for x-ray crystallography.

Peptide H-SINIGPGQVFYRTGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SINIGPGQVFYRTGD-OH include the following: Lactobacillus plantarum induces genomic DNA-dependent and TLR9-mediated elafin secretion from Caco-2 cells Y Hiramatsu, D Sakamoto, T Satho, K Irie - Asian Pac. J. Allergy , 2019 - apjai-journal.orghttps://apjai-journal.org/wp-content/uploads/2019/04/7.pdf Common antibody dependent cell mediated cytotoxicity (ADCC) antibody epitopes of HIV-1 CRF01_AE Env and Gag in early HIV-1 infected individuals S Sangjan, S Ampol, S Tabprasit - Asian Pacific Journal , 2019 - apjai-journal.orghttps://www.apjai-journal.org/wp-content/uploads/2019/04/8.pdf Beta-expansin of Bermuda, Johnson, and Para grass pollens, is a major cross-reactive allergen for Allergic Rhinitis patients in subtropical climate P Pacharn , W Songnual, U Siriwatanakul - Asian Pac J Allergy , 2019 - apjai-journal.orghttps://apjai-journal.org/wp-content/uploads/2019/04/6.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of VTN antibody, catalog no. 70R-9584

A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf153 antibody, catalog no. 70R-3503

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCN3 antibody, catalog no. 70R-1484

m-dPEG®12-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®12-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

LTX-315 (Oncopore), the oncolytic peptide, inhibits cancer cells through Bax/Bak-regulated mitochondrial membrane permeabilization.

Peptide H-YPLTFGWCY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YPLTFGWCY-OH include the following: CD8+ lymphocytes respond to different HIV epitopes in seronegative and infected subjects R Kaul , T Dong , FA Plummer , J Kimani - The Journal of , 2001 - Am Soc Clin Investighttps://www.jci.org/articles/view/12433 Late seroconversion in HIV-resistant Nairobi prostitutes despite pre-existing HIV-specific CD8+ responses R Kaul , SL Rowland-Jones , J Kimani - The Journal of , 2001 - Am Soc Clin Investighttps://www.jci.org/articles/view/10714 New insights into HIV-1 specific cytotoxic T-lymphocyte responses in exposed, persistently seronegative Kenyan sex workers R Kaul , SL Rowland-Jones , J Kimani , K Fowke - Immunology letters, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165247801002607 Monitoring HIV-specific CD8+ T cell responses by intracellular cytokine production MR Betts , JP Casazza, RA Koup - Immunology Letters, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165247801002735 Cytotoxic T lymphocyte epitopes of HIV-1 Nef: generation of multiple definitive major histocompatibility complex class I ligands by proteasomes M Lucchiari-Hartz, PM Van Endert , G Lauvau - The Journal of , 2000 - rupress.orghttps://rupress.org/jem/article-abstract/191/2/239/50980 Immunologic pressure within class I-restricted cognate human immunodeficiency virus epitopes during highly active antiretroviral therapy JP Casazza, MR Betts , BJ Hill, JM Brenchley - Journal of , 2005 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.79.6.3653-3663.2005 Four novel cytotoxic T-lymphocyte epitopes in the highly conserved major homology region of HIV-1 Gag, restricted through B* 4402, B* 1801, A* 2601, B* 70 (B* 1509 GS Ogg , T Dong , P Hansasuta , L Dorrell, J Clarke - Aids, 1998 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/1998/12000/four_novel_cytotoxic_t_lymphocyte_epitopes_in_the.26.aspx Massive CD8 T cell response to primary HIV infection in the setting of severe clinical presentation GS Arnoczy, G Ferrari, N Goonetilleke - AIDS research and , 2012 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/aid.2011.0145 Identification of HLA-C restricted, HIV-1-specific CTL epitopes by peptide induced upregulation of HLA-C expression A Stoll, S Bergmann, C Mummert - Journal of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022175915000083

Peptide H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A include the following: First Demonstration of Antigen Induced Cytokine Expression by CD4-1+ Lymphocytes in a Poikilotherm: Studies in Zebrafish (Danio rerio) S Yoon, S Mitra , C Wyse , A Alnabulsi, J Zou - PloS one, 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0126378 Purification and Characterization of Two Members of the Protein PA Livingston - prokaryotes, 1999 - fau.digital.flvc.orghttps://fau.digital.flvc.org/islandora/object/fau%3A3750/datastream/OBJ/download/Purification_and_characterization_of_two_members_of_the_protein_tyrosine_phosphatase_family.pdf

Peptide H-HSQPWQVLVASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HSQPWQVLVASR^-OH include the following: Targeted proteomics identifies liquid-biopsy signatures for extracapsular prostate cancer Y Kim, J Jeon , S Mejia, CQ Yao, V Ignatchenko - Nature , 2016 - nature.comhttps://www.nature.com/articles/ncomms11906 Selective enrichment and sensitive detection of peptide and protein biomarkers in human serum using polymeric reverse micelles and MALDI-MS N Rodthongkum , R Ramireddy, S Thayumanavan - Analyst, 2012 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2012/an/c2an16089g SRM-MS applications in proteomics M Hossain, M Hossain - Monitoring Mass Spectrometry (SRM-MS) in , 2020 - Springerhttps://link.springer.com/chapter/10.1007/978-3-030-53433-2_7 Allergy to human seminal fluid: cross-reactivity with dog dander M Basagaaca±a, B Bartolome, C Pastor , F Torres - Journal of Allergy and , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674907019501 Absolute quantification methods for Prostate-Specific antigen by Isotope-Dilution mass spectrometry J Wu, J Liu, H Sun, T Xing, X Liu, D Song - Journal of Chromatography B, 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157002322400120X In Vitro Selection of DNA Aptamers Against Prostate Cancer Peptide Biomarkers E Kuguoglu - 2014 - stars.library.ucf.eduhttps://stars.library.ucf.edu/cgi/viewcontent.cgi?article=2803&context=honorstheses1990-2015 Chromosome 19 annotations with disease speciation: a first report from the Global Research Consortium CL Nilsson , F Berven, F Selheim , H Liu - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3008607 Identification of prostate-specific antigen (PSA) isoforms in complex biological samples utilizing complementary platforms aca Vegvari , M Rezeli , C Welinder , J Malm, H Lilja - Journal of , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391910000278

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF275 antibody, catalog no. 70R-9068

A synthetic peptide for use as a blocking control in assays to test for specificity of NCKIPSD antibody, catalog no. 70R-9799

H-Ile-Met-OH is a cytosolic protein that is found in the cytosolic domain of plant cells. H-Ile-Met-OH is an enzyme that catalyzes the conversion of HMBP to Met, which is an intermediate in the biosynthesis of methionine. The frequency and sequence of H-Ile-Met-OH has been analyzed in animals, plants, and fungi. Bioinformatics studies have shown that H-Ile-Met-OH has a vacuolar function, which can be seen by its sequence similarity to other vacuolar proteins.

Targeting of neuronal AChR subtypes containing α6 subunits

Peptide H-VIPELNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VIPELNGK^-OH include the following: Effect of fat concentration on protein digestibility of Chinese sausage T Zhou, B Sheng, H Gao, X Nie, H Sun, B Xing - Food Research , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0963996923014709 Multiple reaction monitoring-based targeted assays for the validation of protein biomarkers in brain tumors S Ghantasala , MGJ Pai , D Biswas , N Gahoi - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2021.548243/full Continuous free-flow electrophoresis separation of cytosolic proteins from the human colon carcinoma cell line LIM 1215: A non two-dimensional gel electrophoresis P Hoffmann, H Ji , RL Moritz - PROTEOMICS , 2001 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/1615-9861(200107)1:7%3C807::AID-PROT807%3E3.0.CO;2-6

A synthetic peptide for use as a blocking control in assays to test for specificity of SCN3B antibody, catalog no. 70R-5225

Peptide H-EFMVFAHAQWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EFMVFAHAQWK-OH include the following: Phenylalanine 90 and 93 are localized within the phenol binding site of human UDP-glucuronosyltransferase 1A10 as determined by photoaffinity labeling, mass Y Xiong, D Bernardi , S Bratton , MD Ward - Biochemistry, 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0519001