Peptides

Catalogue peptide; min. 95% purity

Peptide H-TPL^TATLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TPL^TATLSK^-OH include the following: The possibility of using the PlasmaDeepDive™MRM-panel in clinical diagnostics YV Miroshnichenko, NA Petushkova - ) Supplement Series B , 2015 - Springerhttps://link.springer.com/article/10.1134/S1990750815030051 Optimization of a human milk-directed quantitative sIgA ELISA method substantiated by mass spectrometry KA Dingess, P Van Dam, J Zhu , M Mank - Analytical and , 2021 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03468-4 Quantitative determination of human IgA subclasses and their Fc-glycosylation patterns in plasma by using a peptide analogue internal standard and ultra-high HF Chen, CY Shiao, MY Wu, YC Lin - Rapid , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.8606 Methods for quantification of immunological markers by mass spectrometry technique E Benešova - is.muni.czhttps://is.muni.cz/th/ugn6o/thesis_Benesova_final_public.pdf

Biotinylated version of the Spike (S) glycoprotein which corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of BTG4 antibody, catalog no. 70R-5595

A synthetic peptide for use as a blocking control in assays to test for specificity of NR1I3 antibody, catalog no. 70R-1002

H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 is a potent activator of the human growth hormone receptor, which leads to increased levels of insulin growth factor 1 (IGF1). H-His-D-Trp-Ala-Trp-D-Phe-Lys NH2 causes an increase in locomotor activity and somatotrophs. This peptide has been shown to be effective in treating metabolic disorders such as obesity and diabetes mellitus type 2. It also has antiviral properties that may be useful for the treatment of infectious diseases, such as HIV.

Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K14 antibody, catalog no. 70R-3485

Peptide H-EEGGEEGKRNRVTLADLC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EEGGEEGKRNRVTLADLC-OH include the following: Voltage-gated Ca2+ channel CaV1. 3 subunit expressed in the hair cell epithelium of the sacculus of the trout Oncorhynchus mykiss: cloning and comparison across NA Ramakrishnan, GE Green , R Pasha - Molecular brain , 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0169328X02005223

Peptide H-VLELYSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VLELYSQK^-OH include the following: Correspoiirlence zyxwvutsrqponmlkjihgfedcb A BONCI, L BRACCI, C CAUDAI - Eur. J , 1993 - academia.eduhttps://www.academia.edu/download/42122104/Characterization_of_immunoreactive_octap20160205-30232-1njzwq9.pdf Characterization of immunoreactive octapeptides of human-cytomegalovirus gp58 A BONCI, L Bracci, C CAUDAI , L Lozzi - European journal of , 1993 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1432-1033.1993.tb18044.x

Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RR^-OH include the following: Oligopeptides inhibit the ribonucleotide reductase of herpes simplex virus by causing subunit separation W McClements, G Yamanaka, V Garsky, H Perry - Virology, 1988 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0042682288904217 The studies on the active peptide on smooth muscle in the skin of Rana rugosa, Thr6-bradykinin and its analogous peptide, ranakinin-R T YASUHARA, O ISHIKAWA, T NAKAJIMA - Chemical and , 1979 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/cpb1958/27/2/27_2_486/_article/-char/ja/ Identification of novel short peptide inhibitors of soluble 37/48 kDa oligomers of amyloid beta42 T Kawasaki, K Onodera, S Kamijo - Bioscience, biotechnology, and , 2011 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/bbb/75/8/75_110198/_article/-char/ja/ Development of a peptide-based nano-sized cathepsin B inhibitor for anticancer therapy SH Park , JH Lee , SB Yang , DN Lee, TB Kang, J Park - Pharmaceutics, 2023 - mdpi.comhttps://www.mdpi.com/1999-4923/15/4/1131 Quantitative UV RR Spectroscopy of Artificial Peptide Receptors S Nieblinga, SK Srivastava , C Herrmann - AIP Conference , 2010 - pubs.aip.orghttps://pubs.aip.org/aip/acp/article-abstract/1267/1/883/683515 Chemical reactivity and binding interactions in ribonucleic acid-peptide complexes R Srivastava - Proteins: Structure, Function, and Bioinformatics, 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prot.26272 Synthesis and inhibitory potency of peptides corresponding to the subunit 2 C-terminal region of herpes virus ribonucleotide reductases P Gaudreau , H Paradis, Y Langelier - Journal of medicinal , 1990 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/jm00164a040 Molecular Integrative Analysis of the Inhibitory Effects of Dipeptides on Amyloid beta Peptide 1-42 Polymerization N Yuan, L Ye, Y Sun, H Wu, Z Xiao, W Fu - International Journal of , 2023 - mdpi.comhttps://www.mdpi.com/1422-0067/24/8/7673 A new type of helix pattern in polyalanine peptide HS Son, BH Hong , CW Lee , S Yun - Journal of the American , 2001 - ACS Publicationshttps://pubs.acs.org/doi/full/10.1021/ja0014640 Identifying Cu (ii)-amyloid peptide binding intermediates in the early stages of aggregation by resonance Raman spectroscopy: a simulation study H Ren , Y Zhang , S Guo, N Lin, L Deng, T Yue - Physical Chemistry , 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/cp/c7cp06206k Uncoupled adjacent amide vibrations in small peptides G Mix, R Schweitzer-Stenner - Journal of the American , 2000 - ACS Publicationshttps://pubs.acs.org/doi/full/10.1021/ja0004783 SYNTHESIS OF PEPTIDE ANALOGS OF THE N-TERMINAL EICOSAPEPTIDE SEQUENCE OF RIBONUCLEASE A. Part XV. Synthesis and Guanidination of [Orn10 G Borin, C Toniolo, L Moroder - Journal of Peptide , 1972 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1972.tb03396.x Prorenin binding to (pro) renin receptor and its inhibition by the decoy peptide (RIFLKRMPSI) in vitro F Suzuki , N Nabi , KB Biswas - Journal of the Renin , 2008 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/14703203080090010117 (Pro) renin receptor peptide inhibitor"handle-region" peptide does not affect hypertensive nephrosclerosis in Goldblatt rats DN Muller, B Klanke, S Feldt, N Cordasic, A Hartner - , 2008 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/hypertensionaha.107.101493 The Ï€ configuration of the WWW motif of a short Trp-rich peptide is critical for targeting bacterial membranes, disrupting preformed biofilms, and killing methicillin D Zarena , B Mishra , T Lushnikova, F Wang - Biochemistry, 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.biochem.7b00456 Peptide Mimics of the Cysteine-Rich Regions of HapX and SreA Bind a [2Fe-2S] Cluster In Vitro D Rossetto , L Sebastianelli , S Oberegger - Advanced , 2024 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adbi.202300545 Peptide inhibitors of mammalian ribonucleotide reductase BS Cooperman , Y Gao, C Tan, OB Kashlan - Advances in enzyme , 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0065257105000178 Oligopeptide inhibition of class I ribonucleotide reductases BS Cooperman - Peptide Science, 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.10397 Chemical identification of the amyloid peptide aggregation-prone Al (III)-peptide complexes by resonance Raman signatures: A computational study B Tian, C Cheng, T Yue , N Lin, H Ren - Chemical Physics, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0301010418303677 Proteinase-activated receptor 2: differential activation of the receptor by tethered ligand and soluble peptide analogs B Al-Ani , SJ Wijesuriya, MD Hollenberg - Journal of Pharmacology and , 2002 - ASPEThttps://jpet.aspetjournals.org/content/302/3/1046.short A study of peptide-peptide interaction by matrix-assisted laser desorption/ionization AS Woods , MA Huestis - Journal of the American Society for Mass , 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1016/S1044-0305(00)00197-5 'Decoy peptide'region (RIFLKRMPSI) of prorenin prosegment plays a crucial role in prorenin binding to the (pro) renin receptor AHM Nabi , KB Biswas - International , 2009 - spandidos-publications.comhttps://www.spandidos-publications.com/10.3892/ijmm_00000210 Stable Right- and Left-Handed Peptide Helices containing Calpha-Tetrasubstituted alpha-Amino Acids AA Grauer, C Cabrele , M Zabel - The Journal of Organic , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jo900222g R2 C-terminal peptide inhibition of mammalian and yeast ribonucleotide reductase A Fisher, FD Yang, H Rubin - Journal of medicinal , 1993 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/jm00076a015

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Ac-Arg-Leu-Arg-AMC trifluoroacetate salt is a mitochondrial biogenesis activator that has been shown to increase the levels of proteins in the mitochondria. These proteins are required for mitochondrial membrane potential, ATP production, and protein homeostasis. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt has been shown to increase the number of pluripotency markers in human liver cells and to reduce insulin resistance in animals. The drug also increases the expression of ubiquitin ligases and proteasomes, which are enzymes that degrade damaged proteins. Ac-Arg-Leu-Arg-AMC trifluoroacetate salt may be used for treating liver diseases or disorders as well as obesity.

Peptide LCBiot-SWKDASGWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-SWKDASGWS-OH include the following: The respiratory syncytial virus phosphoprotein, matrix protein, and fusion protein carboxy-terminal domain drive efficient filamentous virus-like particle formation CD Meshram , PS Baviskar , CM Ognibene - Journal of , 2016 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01193-16

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of TNNI1 antibody, catalog no. 70R-1250

A synthetic peptide for use as a blocking control in assays to test for specificity of ITGA8 antibody, catalog no. 70R-6849

The Green Fluorescent Protein Recombinant is a highly versatile product that offers a wide range of applications in the field of proteomics. This PEG-linked peptide is designed to enhance the stability and solubility of proteins, making it an ideal choice for various research purposes. With its unique PEG-protected structure, this recombinant protein ensures optimal performance and long-lasting results. Whether you're conducting protein-protein interaction studies or investigating protein localization, this PEGylated peptide will provide you with accurate and reliable data. Trust in the exceptional quality of this product to advance your research and unlock new insights in the world of proteomics.

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB9A antibody, catalog no. 70R-8643

A-71915 (TFA) selectively blocks ANP receptor, causing cell death and reduced insulin in RINm5F β-cells.

Peptide Ac-AAAAAAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-AAAAAAK-NH2 include the following: The relationship between the connecting peptide of recombined single chain insulin and its biological function Y Huang, Z Liang, Y Feng - Science in China Series C: Life Sciences, 2001 - Springerhttps://link.springer.com/article/10.1007/BF02879353 Amino-Acid-Encoded Bioinspired Supramolecular Self-Assembly of Multimorphological Nanocarriers Y Huang, G Yang, Z Yu, T Tong, Y Huang, Q Zhang - Small, 2024 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/smll.202311351 Geometrical shape of hydrophobic section determines the self-assembling structure of peptide detergents and bolaamphiphilic peptides Y Chen, F Qiu , Y Lu, YK Shi, X Zhao - Current Nanoscience, 2009 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cnano/2009/00000005/00000001/art00010 PEPTIDE SELF-ASSEMBLY BIOMATERIALS DESIGN AND APPLICATION X Zhao, S Wang, Y Lu, J Cheng - Biologically-responsive Hybrid , 2010 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=PbzFCgAAQBAJ&oi=fnd&pg=PA83&dq=(%22Ac-Ala-Ala-Ala-Ala-Ala-Ala-Lys-amide%22+OR+%22Ac-AAAAAAK-NH2%22+OR+%22AAAAAAK%22)+AND+peptide&ots=4qJAIxUgfU&sig=v6_zTPpMS7svKZU7EGK6hdwxnJc Self-Assembling Behavior of pH-Responsive Peptide A6K without End-Capping P Zhang, F Wang, Y Wang, S Li, S Wen - Molecules, 2020 - mdpi.comhttps://www.mdpi.com/1420-3049/25/9/2017 Self-assembling peptide detergents stabilize isolated photosystem I on a dry surface for an extended time. P Kiley, X Zhao, M Vaughn , MA Baldo , BD Bruce - PLoS , 2005 - europepmc.orghttps://europepmc.org/article/pmc/1151599 Self-assembling peptide detergents stabilize isolated photosystem ion a dry surface for an extended time P Kiley, X Zhao , M Vaughn , MA Baldo , BD Bruce - PLoS , 2005 - journals.plos.orghttps://journals.plos.org/plosbiology/article?id=10.1371/journal.pbio.0030230 Fibrils and nanotubes assembled from a modified amyloid-beta peptide fragment differ in the packing of the same beta-sheet building blocks J Madine , HA Davies, C Shaw , IW Hamley - Chemical , 2012 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2012/cc/c2cc17118j Comparative studies on the self-assembling behaviors of cationic and catanionic surfactant-like peptides F Qiu , Y Chen, X Zhao - Journal of colloid and interface science, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021979709004470 A Simple Method for Cell Sheet Fabrication Using Mica Surfaces Grafted with Peptide Detergent A6K F Qiu , Y Chen, J Cheng, C Wang - Macromolecular , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/mabi.200900360 Insights into the molecular architecture of a peptide nanotube using FTIR and solid-state NMR spectroscopic measurements on an aligned sample DA Middleton, J Madine , V Castelletto - Angewandte Chemie , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/anie.201301960 A comparison of positive and negative ion collision-induced dissociation for model heptapeptides with one basic residue D Pu, NL Clipston, CJ Cassady - Journal of mass spectrometry, 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.1715 Applications of de novo designed peptides AL Boyle - Peptide applications in biomedicine, Biotechnology , 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B978008100736500003X Dynamic behaviors of lipid-like self-assembling peptide A6D and A6K nanotubes A Nagai, Y Nagai, H Qu, S Zhang - Journal of nanoscience and , 2007 - ingentaconnect.comhttps://www.ingentaconnect.com/contentone/asp/jnn/2007/00000007/00000007/art00006

H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of COL4A6 antibody, catalog no. 70R-9964

Peptide H-MVTGVASALSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MVTGVASALSSR-OH include the following: KLF1 mutation E325K induces cell cycle arrest in erythroid cells differentiated from congenital dyserythropoietic anemia patient-specific induced pluripotent H Kohara, T Utsugisawa, C Sakamoto, L Hirose - Experimental , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0301472X19301286

Peptide H-LREQLGPVTQEFWDNLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LREQLGPVTQEFWDNLEK^-OH include the following: A comparative proteomics analysis of peritoneal dialysate before and after the occurrence of peritonitis episode by mass spectrometry YC Tyan, SB Su , SS Ting, HY Wang, PC Liao - Clinica Chimica Acta, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009898112004779 Differentiating vitreous proteomes in proliferative diabetic retinopathy using high-performance liquid chromatography coupled to tandem mass spectrometry H Wang, L Feng, J Hu, C Xie, F Wang - Experimental eye research, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014483512003557 Hereditary hepatic and systemic amyloidosis caused by a new deletion/insertion mutation in the apolipoprotein AI gene. DR Booth , SY Tan, SE Booth - The Journal of , 1996 - Am Soc Clin Investighttps://www.jci.org/articles/view/118725

A synthetic peptide for use as a blocking control in assays to test for specificity of HLA-DPA1 antibody, catalog no. 70R-5980

Peptide H-ALVLIAFAQYLQQCPFEDHVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALVLIAFAQYLQQCPFEDHVK^-OH include the following: Determination of modification sites and relative quantitation in large protein conjugation via automated data processing Z Lai, Z Liang , L Yan, X Qian, H Jiang - Journal of Pharmaceutical , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708521001072 Hydrolysis of homocysteine thiolactone results in the formation of Protein-Cys-S-S-homocysteinylation Y Silla, S Varshney , A Ray , T Basak - Proteins: Structure , 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prot.25681 Abacavir forms novel cross-linking abacavir protein adducts in patients X Meng , AS Lawrenson , NG Berry - Chemical research in , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/tx400406p An EThcD-based method for discrimination of leucine and isoleucine residues in tryptic peptides SS Zhokhov, SV Kovalyov, TY Samgina - Journal of The , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-017-1674-3 Serum albumin cysteine trioxidation is a potential oxidative stress biomarker of type 2 diabetes mellitus S Paramasivan, SS Adav , SFC Ngan, R Dalan - Scientific Reports, 2020 - nature.comhttps://www.nature.com/articles/s41598-020-62341-z Sulfenic acid formation in human serum albumin by hydrogen peroxide and peroxynitrite S Carballal, R Radi, MC Kirk, S Barnes - Biochemistry, 2003 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi027434m Label-free LC-MS method for the identification of biomarkers RE Higgs , MD Knierman , V Gelfanova, JP Butler - : Methods and Protocols, 2008 - Springerhttps://link.springer.com/protocol/10.1007/978-1-59745-117-8_12 Antibody enrichment and mass spectrometry of albumin-Cys34 adducts MK Chung , H Grigoryan, AT Iavarone - Chemical research in , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/tx400337k Functionalized quinolizinium-based fluorescent reagents for modification of cysteine-containing peptides and proteins KKY Kung, C Xu, O Wa-Yi, Q Yu, SF Chung, SY Tam - RSC , 2022 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2022/ra/d1ra08329e Oxidative albumin damage in chronic liver failure: relation to albumin binding capacity, liver dysfunction and survival K Oettl, R Birner-Gruenberger , W Spindelboeck - Journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168827813004297 GILT expression in human melanoma cells enhances generation of antigenic peptides for HLA class II-mediated immune recognition JD Hathaway-Schrader, D Norton, K Hastings - International Journal of , 2022 - mdpi.comhttps://www.mdpi.com/1422-0067/23/3/1066 Multiple adduction reactions of nitroso sulfamethoxazole with cysteinyl residues of peptides and proteins: implications for hapten formation HE Callan, RE Jenkins, JL Maggs - Chemical research in , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/tx900034r Quantification of a peptide standard using the intrinsic fluorescence of tyrosine GW Preston, DH Phillips - Analytical and bioanalytical chemistry, 2016 - Springerhttps://link.springer.com/article/10.1007/s00216-016-9334-1 Irreversible Alkylation of Human Serum Albumin by Zileuton Metabolite 2-Acetylbenzothiophene-S-oxide: A Potential Model for Hepatotoxicity F Li, MD Chordia , KA Woodling - Chemical research in , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/tx7001417 Characterization of p-phenylenediamine-albumin binding sites and T-cell responses to hapten-modified protein C Jenkinson, RE Jenkins, M Aleksic - Journal of investigative , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022202X15347345 Detection of busulfan adducts on proteins AE Acosta-Martin, P Antinori - Rapid , 2016 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.7730 Definition of haptens derived from sulfamethoxazole: in vitro and in vivo A Tailor , JC Waddington, J Hamlett - Chemical research in , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.chemrestox.9b00282

Custom research peptide; min purity 95%.

Peptide H-IEIKDTKEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IEIKDTKEAL-OH include the following: Nef-mediated resistance of human immunodeficiency virus type 1 to antiviral cytotoxic T lymphocytes OO Yang , PT Nguyen, SA Kalams , T Dorfman - Journal of , 2002 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.76.4.1626-1631.2002 Identification of dominant optimal HLA-B60-and HLA-B61-restricted cytotoxic T-lymphocyte (CTL) epitopes: rapid characterization of CTL responses by enzyme-linked MA Altfeld, A Trocha, RL Eldridge - Journal of , 2000 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.74.18.8541-8549.2000 Supplemental Table 1. List of HIV class I peptides. M End - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/ed0f/0f087694817c860c5aad97fab618403c2847.pdf beta-chemokines are released from HIV-1-specific cytolytic T-cell granules complexed to proteoglycans L Wagner , OO Yang , EA Garcia-Zepeda, Y Ge - Nature, 1998 - nature.comhttps://www.nature.com/articles/36129 Resistance mutations and CTL epitopes in archived HIV-1 DNA of patients on antiviral treatment: toward a new concept of vaccine J Papuchon, P Pinson, E Lazaro, S Reigadas - PloS one, 2013 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0069029 Migration ofAntigen-Specific T Cells Away from CXCR4-Binding Human ImmunodeficiencyVirus Type 1gp120 DM Brainard, WG Tharp, E Granado, N Miller - Journal of , 2004 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.78.10.5184-5193.2004

A synthetic peptide for use as a blocking control in assays to test for specificity of BRWD1 antibody, catalog no. 70R-2548

Peptide H-FGEENIEVYHSYFWPLEWTIPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FGEENIEVYHSYFWPLEWTIPSR-OH include the following: Thioredoxin and thioredoxin reductase influence estrogen receptor alpha-mediated gene expression in human breast cancer cells AK Rao, YS Ziegler, IX McLeod, JR Yates - Journal of molecular , 2009 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC2994277/

A synthetic peptide for use as a blocking control in assays to test for specificity of CDK5 antibody, catalog no. 20R-1202

Peptide H-YVRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YVRPLWVRME-OH include the following: Pathogenic T cells have a paradoxical protective effect in murine autoimmune diabetes by boosting Tregs Y Grinberg-Bleyer, D Saadoun - The Journal of , 2010 - Am Soc Clin Investighttps://www.jci.org/articles/view/42945 Formulation of hydrophobic peptides for skin delivery via coated microneedles X Zhao, SA Coulman, SJ Hanna, FS Wong - Journal of Controlled , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365916311907 Asparaginyl ligase-catalyzed one-step cell surface modification of red blood cells TJ Harmand , N Pishesha , FBH Rehm, W Ma - ACS Chemical , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschembio.1c00216 Engineering antigens for in situ erythrocyte binding induces T-cell deletion S Kontos, IC Kourtis , KY Dane - Proceedings of the , 2013 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1216353110 Fungal beta-glucan, a Dectin-1 ligand, promotes protection from type 1 diabetes by inducing regulatory innate immune response S Karumuthil-Melethil, R Gudi, BM Johnson - The Journal of , 2014 - journals.aai.orghttps://journals.aai.org/jimmunol/article/193/7/3308/98349 Activation of T cell checkpoint pathways during beta-cell antigen presentation by engineered dendritic cells promotes protection from type 1 diabetes RR Gudi, N Perez , S Karumuthil-Melethil, G Li - , 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/imm.13476 Complex dietary polysaccharide modulates gut immune function and microbiota, and promotes protection from autoimmune diabetes R Gudi, N Perez , BM Johnson, MH Sofi , R Brown - , 2019 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/imm.13048 Prevention of type 1 diabetes with acetalated dextran microparticles containing rapamycin and pancreatic peptide P31 N Chen, CJ Kroger, RM Tisch - Advanced , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/adhm.201800341 Polysaccharide A-Dependent Opposing Effects of Mucosal and Systemic Exposures to Human Gut Commensal Bacteroides fragilis in Type 1 Diabetes MH Sofi , BM Johnson, RR Gudi, A Jolly - Diabetes, 2019 - Am Diabetes Assochttps://diabetesjournals.org/diabetes/article-abstract/68/10/1975/35369 Cutting edge: type 1 diabetes occurs despite robust anergy among endogenous insulin-specific CD4 T cells in NOD mice KE Pauken , JL Linehan , JA Spanier - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/191/10/4913/86896 Insights into the percutaneous penetration of antidiabetic agents K Ita - Journal of Drug Targeting, 2017 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/1061186X.2016.1221956 Peptide-MHC class II dimers as therapeutics to modulate antigen-specific T cell responses in autoimmune diabetes EL Masteller, MR Warner, W Ferlin - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/171/10/5587/1785 Engineered RBCs encapsulating antigen induce multi-modal antigen-specific tolerance and protect against type 1 diabetes CJ Raposo , JD Cserny, G Serena, JN Chow - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2022.869669/full CD11c+ Cells Are Gatekeepers for Lymphocyte Trafficking to Infiltrated Islets During Type 1 Diabetes AM Sandor, RS Lindsay, N Dyjack - Frontiers in , 2019 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2019.00099/full

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-IMIGVLVGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IMIGVLVGV-OH include the following: Assessment of cancer and virus antigens for cross-reactivity in human tissues V Jaravine, S Raffegerst, DJ Schendel - , 2017 - academic.oup.comhttps://academic.oup.com/bioinformatics/article-abstract/33/1/104/2525678 Targeting cancers through TCR-peptide/MHC interactions Q He, X Jiang, X Zhou, J Weng - Journal of hematology & oncology, 2019 - Springerhttps://link.springer.com/article/10.1186/s13045-019-0812-8 T-Cell Receptor-Transduced T Cells: Clinical Experience PF Robbins - The Cancer Journal, 2015 - journals.lww.comhttps://journals.lww.com/journalppo/FullText/2015/11000/T_Cell_Receptor_Transduced_T_Cells__Clinical.7.aspx On-and off target toxicity profiling for adoptive cell therapy by mass spectrometry-based immunopeptidome analysis of primary human normal tissues O Schoor, J Fritsche, S Kutscher, A Mahr - Cancer Research, 2016 - AACRhttps://aacrjournals.org/cancerres/article-abstract/76/14_Supplement/2291/609438 Characterization of genetically modified T-cell receptors that recognize the CEA: 691-699 peptide in the context of HLA-A2. 1 on human colorectal cancer cells MR Parkhurst, J Joo, JP Riley, Z Yu, Y Li - Clinical Cancer , 2009 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/15/1/169/73405 Carcinoembryonic antigen (CEA)-based cancer vaccines: recent patents and antitumor effects from experimental models to clinical trials M Turriziani, M Fantini , M Benvenuto - Recent patents on , 2012 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/pra/2012/00000007/00000003/art00004 Signaling via a CD28/CD40 chimeric costimulatory antigen receptor (CoStAR™), targeting folate receptor alpha, enhances T cell activity and augments tumor M Kalaitsidou, OR Moon, M Sykorova, L Bao - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2023.1256491/full Carcinoembryonic antigen transgenic mouse models for immunotherapy and development of cancer vaccines M Bhattacharya-Chatterjee, A Saha - Current Protocols in , 2008 - Wiley Online Libraryhttps://currentprotocols.onlinelibrary.wiley.com/doi/abs/10.1002/0471142735.im2008s80 TAP-independent presentation of CTL epitopes by Trojan antigens J Lu, PJ Wettstein, Y Higashimoto - The Journal of , 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/166/12/7063/33891 A novel transgenic mouse model for immunological evaluation of carcinoembryonic antigen-based DNA minigene vaccines H Zhou, Y Luo, M Mizutani, N Mizutani - The Journal of , 2004 - Am Soc Clin Investighttps://www.jci.org/articles/view/21107 Enhancing immunogenicity of a CTL epitope from carcinoembryonic antigen by selective amino acid replacements E Huarte , P Sarobe, J Lu, N Casares, JJ Lasarte - Clinical cancer , 2002 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/8/7/2336/289158 Identification and validation of viral antigens sharing sequence and structural homology with tumor-associated antigens (TAAs). C Ragone, C Manolio, B Cavalluzzo - for ImmunoTherapy of , 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8166618/

Peptide H-GDQGPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GDQGPVGR^-OH include the following: Targeted proteomics for the analysis of cultural heritage: application of broadband collision-induced dissociation mass spectrometry Y Dubrovskii , T Krivul'ko, L Gavrilenko - Analytical and , 2022 - Springerhttps://link.springer.com/article/10.1007/s00216-021-03805-7 Determination and quantification of collagen types in tissues using HPLC-MS/MS S Pataridis, A Eckhardt, K Mikulikova - Current analytical , 2009 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cac/2009/00000005/00000004/art00004 Proteomic strategies for cultural heritage: from bones to paintings R Vinciguerra, A De Chiaro, P Pucci , G Marino - Microchemical , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0026265X15003689

Catalogue peptide; min. 95% purity

C-type natriuretic peptide (CNP) is a novel urinary biomarker which is part of the natriuretic peptide family. CNP is produced in the kidney and the endothelium and has been localised to renal tubules. CNP expression has also been detected in cardiomyocytes, vascular endothelium, and bone.CNP is synthesized as the precursor 103 amino acid (AA) protein, proCNP (AA 1-103), which is then cleaved into NT-proCNP (AA 1-50) and CNP53 (AA 51-103) by the intracellular endoprotease furin. CNP53 is then cleaved to give the biologically active mature form CNP22 (AA 82-103) and inactive form NT-CNP53 (51-81). CNP primarily acts as an autocrine or paracrine factor and has anti-proliferative and anti-fibrotic properties, including suppression of fibroblast proliferation and collagen production, inhibition of vascular smooth muscle cell proliferation and accelerated regeneration of endothelial cells. CNP is a vasodilator and potent venodilator and slightly elevated levels have been detected in heart failure and renal disease states. CNP has renoprotective properties and is activated during renal injury, where it helps preserve glomerular function and suppress pro-fibrotic processes. Hypoxia, cytokines and fibrotic growth factors, are stimuli for CNP production and release.CNP selectively activates the cell surface particulate guanylyl cyclase receptor B (GC-B), catalysing the conversion of GTP to the downstream second messenger, cyclic guanosine monophosphate (cGMP).

Peptide H-GTIQVITQGTSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GTIQVITQGTSLK-OH include the following: INPP5K and SIL1 associated pathologies with overlapping clinical phenotypes converge through dysregulation of PHGDH D Hathazi , D Cox , A d'Amico, G Tasca , R Charlton - Brain, 2021 - academic.oup.comhttps://academic.oup.com/brain/article-abstract/144/8/2427/6207983

Salusin-Alpha is a human protein that belongs to the peptide family. It has the ability to activate a receptor and is used in research as a pharmacology and cell biology tool. Salusin-Alpha binds to ion channels and inhibits their function, which may be due to its ability to inhibit ligand binding. Salusin-Alpha is used in research as an inhibitor of peptides and antibodies, which are used in research as receptor ligands. This product has been shown to have high purity, with no detectable contaminants such as proteases, lipases, or nucleases. The CAS number for this product is 624735-22-4.

Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SL^EDLQL^THNK^-OH include the following: Multiplex targeted proteomic assay for biomarker detection in plasma: a pancreatic cancer biomarker case study S Pan, R Chen, RE Brand, S Hawley - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr201117w

Peptide H-AETSELHTSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AETSELHTSLK^-OH include the following: Highly sensitive impurity detection and identification in biologics W Jin, L Burton, S Gotta, D Simmons, K Pohl - sciex.comhttps://sciex.com/content/dam/SCIEX/tech-notes/biopharma/ruo-mkt-02-13736-a/RUO-MKT-02-13736-A_Impurity%20detection%207600%20and%20Biologics%20Explorer.pdf Clinical classifiers of COVID-19 infection from novel ultra-high-throughput proteomics CB Messner , V Demichev , D Wendisch, L Michalick - MedRxiv, 2020 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2020.04.27.20081810.abstract

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIT1 antibody, catalog no. 70R-7956

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNC4 antibody, catalog no. 70R-5155

Peptide H-EPDRAHYNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EPDRAHYNI-OH include the following: Both Immunization with Protein and Recombinant Vaccinia Virus Can Stimulate CTL Specific for the E7 Protein of Human Papilloma Virus 16 in H-2d Mice X Zhu, M Tommasino, K Vousden - Scandinavian , 1995 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-3083.1995.tb03696.x

Peptide H-V^IFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-V^IFDANAPVAVR^-OH include the following: Thyroglobulin and thyroid cancer WS Phipps, AN Hoofnagle , MY Roth, CM Shuford - Cancer Biomarkers, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780128243022000060 Klinisyenler Ä°aca§in Tiroglobulin aca–laca§um Yöntemleri UA Gaca–KSU - GaziosmanpaÃ…Åža universitesi Tıp Fakultesi Dergisi, 2021 - dergipark.org.trhttps://dergipark.org.tr/en/pub/gutfd/issue/65466/1011845 Antibody based affinity capture LC-MS/MS in quantitative determination of proteins in biological matrices TG Halvorsen , L Reubsaet - TrAC Trends in Analytical Chemistry, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165993617301784 Precision of heavy-light peptide ratios measured by MALDI-TOF mass spectrometry NL Anderson , M Razavi, TW Pearson - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr201092v A novel mass spectrometry-based assay for the accurate measurement of thyroglobulin from patient samples containing antithyroglobulin autoantibodies NJ Clarke , Y Zhang, RE Reitz - Journal of Investigative , 2012 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.2310/JIM.0b013e318276deb4 Measurement of thyroglobulin by LC-MS/MS in serum and plasma in presence of anti-thyroglobulin autoantibodies MM Kushnir, AL Rockwood, WL Roberts - Clinical , 2013 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4016991/ Measurement of thyroglobulin by liquid chromatography-tandem mass spectrometry in serum and plasma in the presence of antithyroglobulin autoantibodies MM Kushnir, AL Rockwood, WL Roberts - Clinical , 2013 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/59/6/982/5621949 Liquid chromatography mass spectrometry based characterization of epitope configurations MCS LevernacaŠs, AU Moe, SL Boe, E Paus - Analytical , 2020 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2020/ay/d0ay01283a Influence of Thyroglobulin (Tg) Autoantibodies on Tg levels Measured by Different Methodologies:(IMA, LC-MS/MS and RIA) I Petrovic, J LoPresti, S Fatemi - The Journal of , 2024 - academic.oup.comhttps://academic.oup.com/jcem/advance-article-abstract/doi/10.1210/clinem/dgae286/7659925 Serum thyroglobulin evaluation on LC-MS/MS and immunoassay in TgAb-positive patients with papillary thyroid carcinoma E Nishihara, Y Hobo, A Miyauchi, Y Ito - European Thyroid , 2022 - etj.bioscientifica.comhttps://etj.bioscientifica.com/view/journals/etj/11/1/ETJ-21-0041.xml First Steps Toward Harmonization of LC-MS/MS Thyroglobulin Assays To the Editor DI TgIA, B Coulter - Clinical Chemistry, 2016 - researchgate.nethttps://www.researchgate.net/profile/Stefan-Grebe/publication/282425553_First_Steps_toward_Harmonization_of_LC-MSMS_Thyroglobulin_Assays/links/5645f67108ae9f9c13e7295b/First-Steps-toward-Harmonization-of-LC-MS-MS-Thyroglobulin-Assays.pdf First steps toward harmonization of LC-MS/MS thyroglobulin assays BC Netzel, RP Grant, AN Hoofnagle - Clinical , 2016 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/62/1/297/5611812 Epitopfisking og LC-MS i bestemmelse av tyreoglobulin-Kan LC-MS brukes til karakterisering av epitopkonfigurasjon? AU Moe - 2018 - duo.uio.nohttps://www.duo.uio.no/bitstream/handle/10852/63517/8/1805015-Masteroppgave-PDF.pdf Improving the measurement of serum thyroglobulin with mass spectrometry AN Hoofnagle , MY Roth - The Journal of Clinical Endocrinology , 2013 - academic.oup.comhttps://academic.oup.com/jcem/article-abstract/98/4/1343/2536676 Quantification of thyroglobulin, a low-abundance serum protein, by immunoaffinity peptide enrichment and tandem mass spectrometry AN Hoofnagle , JO Becker, MH Wener - Clinical , 2008 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/54/11/1796/5628645 Insights into the posttranslational structural heterogeneity of thyroglobulin and its role in the development, diagnosis, and management of benign and malignant ACW Xavier, RMB Maciel , JGH Vieira - of endocrinology and , 2016 - SciELO Brasilhttps://www.scielo.br/j/aem/a/fVwmt5dfKjxwxXgjJJxgM7H/?lang=en Rapid and accurate quantitation of thyroglobulin biomarkers using the Echo® MS+ system with ZenoTOF 7600 system A Stella, JW McCabe, A Bhalkikar - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/biopharma/MKT-31267-A_Rapid_peptide_quant_FINAL_KAW_JM_APS_v4_JK.pdf Automated, rapid method optimization and buffer screening using the Echo® MS+ system with ZenoTOF 7600 system A Stella, JW McCabe, A Bhalkikar - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/pharma/MKT-30777-1_Automated_%20rapid_method_optimization_and_buffer_screening_using_the_Echo_MS_system_with_ZenoTOF_7600_system_Final.pdf Antibody Characterization for use in Clinical Mass Spectrometry A Moore - 2018 - digital.lib.washington.eduhttps://digital.lib.washington.edu/researchworks/handle/1773/42880 Thyroglobulin measurement in the management of patients with differentiated thyroid cancer A Algeciras-Schimnich - Critical Reviews in Clinical Laboratory , 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/10408363.2018.1450830

Peptide H-GCTVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GCTVCG-OH include the following: Histidine Ligated Iron-Sulfur Peptides L Valer , D Rossetto , T Parkkila, L Sebastianelli- ..., 2022 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.202200202 Histidine ligated Iron-Sulfur Proteins and Peptides L Valer - 2022 - iris.unitn.ithttps://iris.unitn.it/handle/11572/355641

Peptide H-NIFSFYLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NIFSFYLNR-OH include the following: Proteomic analysis of placentas from cloned cat embryos identifies a set of differentially expressed proteins related to oxidative damage, senescence and apoptosis JI Bang, DW Bae, HS Lee, GK Deb, MO Kim - , 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000772

Peptide H-CINGVCWTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CINGVCWTV-OH include the following: Hepatitis C Virus Attenuates Interferon-Induced MHC Class I Expression and Decreases CD8+ T-Cell Effector Functions W Kang, PS Sung , SH Park, S Yoon, DY Chang - , 2014 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4478444/ Hepatitis C virus attenuates interferon-induced major histocompatibility complex class I expression and decreases CD8+ T cell effector functions W Kang, PS Sung , SH Park , S Yoon, DY Chang, S Kim - Gastroenterology, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0016508514001450 Hepatitis C virus-cross-reactive TCR gene-modified T cells: a model for immunotherapy against diseases with genomic instability TT Spear, TP Riley, GE Lyons - Journal of Leucocyte , 2016 - academic.oup.comhttps://academic.oup.com/jleukbio/article-abstract/100/3/545/6932858 The impairment of CD8 responses limits the selection of escape mutations in acute hepatitis C virus infection S Urbani, B Amadei, E Cariani, P Fisicaro - The Journal of , 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/175/11/7519/36899 PD-1 expression in acute hepatitis C virus (HCV) infection is associated with HCV-specific CD8 exhaustion S Urbani, B Amadei, D Tola, M Massari - Journal of , 2006 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.01177-06 Computational identification of a multi-peptide vaccine candidate in E2 glycoprotein against diverse hepatitis c virus genotypes S Kumari, A Kessel , D Singhal, G Kaur - Journal of , 2023 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2023.2212777 Screening for HCV-specific T cell responses: the use of peptide pools impair the proliferation of antigen specific CD8 T-cells PV Suneetha , V Schlaphoff, C Wang - Zeitschrift fur , 2008 - thieme-connect.comhttps://www.thieme-connect.com/products/ejournals/abstract/10.1055/s-2008-1037618 Cross-genotype-reactivity of the immunodominant HCV CD8 T-cell epitope NS3-1073 P Fytili, GN Dalekos , V Schlaphoff, PV Suneetha - Vaccine, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X08006038 HLA class I-restricted cytotoxic T lymphocytes specific for hepatitis C virus. Identification of multiple epitopes and characterization of patterns of cytokine release. MJ Koziel , D Dudley, N Afdhal - The Journal of , 1995 - Am Soc Clin Investighttps://www.jci.org/articles/view/118287 Immunogenicity and cross-reactivity of a representative ancestral sequence in hepatitis C virus infection KP Burke, S Munshaw , WO Osburn - The Journal of , 2012 - journals.aai.orghttps://journals.aai.org/jimmunol/article/188/10/5177/85391 Molecular footprints reveal the impact of the protective HLA-A* 03 allele in hepatitis C virus infection K Fitzmaurice , D Petrovic , N Ramamurthy, R Simmons - Gut, 2011 - gut.bmj.comhttps://gut.bmj.com/content/60/11/1563.short 625 POLYMORPHISMS IN TOLL-LIKE RECEPTORS 1 AND 2 ARE NOT ASSOCIATED WITH HEPATOCELLULAR CARCINOMA IN CHRONIC HEPATITIS C HD Nischalke, B Reich, K Aldenhoff - Journal of , 2008 - academia.eduhttps://www.academia.edu/download/46950427/s0168-8278_2808_2960627-320160702-17736-1ytx5dv.pdf Liver-infiltrating lymphocytes in chronic human hepatitis C virus infection display an exhausted phenotype with high levels of PD-1 and low levels of CD127 H Radziewicz, CC Ibegbu, ML Fernandez - Journal of , 2007 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.02021-06 The use of class-I HLA tetramers for the detection of hepatitis C virus NS3-specific CD8+ T cells in patients with chronic infection FX Lopez-Labrador, XS He, M Berenguer - Journal of , 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022175904000675 Structural allele-specific patterns adopted by epitopes in the MHC-I cleft and reconstruction of MHC: peptide complexes to cross-reactivity assessment DA Antunes , GF Vieira , MM Rigo , SP Cibulski - PloS one, 2010 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0010353 Fiber-modified recombinant adenoviral constructs encoding hepatitis C virus proteins induce potent HCV-specific T cell response D Thammanichanond, S Moneer , P Yotnda, C Aitken - Clinical , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1521661608006219 Immunogenicity and safety of different injection routes and schedules of IC41, a Hepatitis C virus (HCV) peptide vaccine C Firbas, T Boehm, V Buerger, E Schuller, N Sabarth - Vaccine, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X10000083 Identification of naturally processed hepatitis C virus-derived major histocompatibility complex class I ligands B Wölk, C Trautwein, B Buchele, N Kersting, HE Blum - PloS one, 2012 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0029286&imageURI=info:doi/10.1371/journal.pone.0029286.g003 Linking the T cell receptor to the single cell transcriptome in antigen-specific human T cells AA Eltahla , S Rizzetto , MR Pirozyan - Immunology and cell , 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1038/icb.2016.16 Upregulation of CXCR3 expression on CD8+ T cells due to the pervasive influence of chronic hepatitis B and C virus infection A de Niet, J de Bruijne, MJT Plat-Sinnige - Human immunology, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0198885913001031 Responses of peptide-specific T cells to stimulation with polystyrene beads carrying HLA class I molecules loaded with single peptides A Chersi, R Galati , D Accapezzato , V Francavilla - Journal of , 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022175904001644

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ33790 antibody, catalog no. 70R-3788

Peptide H-DGFFGNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DGFFGNPR-OH include the following: Quantification of peptides from immunoglobulin constant and variable regions by liquid chromatography-multiple reaction monitoring mass spectrometry for ER Remily-Wood, K Benson , RC Baz - Proteomics. Clinical , 2014 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4302417/ Quantification of peptides from immunoglobulin constant and variable regions by LC-MRM MS for assessment of multiple myeloma patients ER Remily-Wood, K Benson , RC Baz - Proteomics-Clinical , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201300077 Evaluation of protein quantification using standard peptides containing single conservative amino acid replacements ER Remily-Wood, JM Koomen - Journal of mass spectrometry, 2012 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.2053

Peptide H-SLLTSSKGQLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLLTSSKGQLQK-OH include the following: HLA ligand profiles of primary renal cell carcinoma maintained in metastases JS Stickel, AO Weinzierl, N Hillen, O Drews - Cancer immunology , 2009 - Springerhttps://link.springer.com/article/10.1007/s00262-008-0655-6 Mass spectrometric analysis of the HLA class I peptidome of melanoma cell lines as a promising tool for the identification of putative tumor-associated HLA epitopes A Gloger, D Ritz, T Fugmann, D Neri - Cancer Immunology , 2016 - Springerhttps://link.springer.com/article/10.1007/s00262-016-1897-3

Peptide derived from the HIV transactivator of transcription protein. TAT is a cationic cell-penetrating peptide.

A synthetic peptide for use as a blocking control in assays to test for specificity of Zkscan1 antibody, catalog no. 70R-7994

A synthetic peptide for use as a blocking control in assays to test for specificity of ENOSF1 antibody, catalog no. 70R-3354

Peptide H-ETIPLQETSLYTQDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ETIPLQETSLYTQDR-OH include the following: Ultrasensitive quantification method for understanding biologically relevant concentrations of host cell proteins in therapeutics S Zhang , B Zhao , S Adaniya , H Xiao, N Li - Analytical Chemistry, 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.3c00020

Peptide H-IGEWAFWETKKNLTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IGEWAFWETKKNLTR-OH include the following: Construction and evaluation of DNA vaccine encoding Ebola virus glycoprotein fused with lysosome-associated membrane protein Y Liu, B Sun, J Pan, Y Feng, W Ye, J Xu, M Lan, H Sun - Antiviral Research, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166354221001315

Peptide H-TVESLFPEEAETPGSAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TVESLFPEEAETPGSAVR^-OH include the following: Vacuum Insulated Probe Heated Electrospray Ionization Source Enhances Microflow Rate Chromatography Signals in the Bruker timsTOF Mass Spectrometer MK Midha , C Kapil , M Maes , DH Baxter - Journal of proteome , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.3c00305

Peptide Ac-KKARFSRFAGSSPSQSSMVAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-KKARFSRFAGSSPSQSSMVAR-NH2 include the following: The kinase activities of interleukin-1 receptor associated kinase (IRAK)-1 and 4 are redundant in the control of inflammatory cytokine expression in human cells KW Song, FX Talamas, RT Suttmann, PS Olson - Molecular , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589008007955 Cutting edge: IL-1 receptor-associated kinase 4 structures reveal novel features and multiple conformations A Kuglstatter, AG Villasenor, D Shaw - The Journal of , 2007 - journals.aai.orghttps://journals.aai.org/jimmunol/article/178/5/2641/74301

Lysyl-prolyl-isoleucyl-glutamyl-phenylalanyl-4-nitrophenylalanyl-arginyl-leucine is a bioactive chemical.

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM27 antibody, catalog no. 70R-8046

JAK3tide is a synthetic peptide, which is a highly specific substrate. Derived from comprehensive biochemical studies, it targets the catalytic activity of the Janus kinase 3 (JAK3) enzyme. JAK3tide's mode of action involves being phosphorylated by JAK3, an essential kinase involved in the signaling pathways of certain cytokines, making it a vital tool for assaying JAK3 activity.When used in in vitro kinase assays, it enables precise quantification of JAK3's enzymatic activity, which is pivotal for understanding pathway dynamics involved in immune responses. Its application extends to research areas focused on elucidating the mechanisms of immune signaling pathways and for the development of inhibitors as potential therapeutic agents in immunological disorders. JAK3tide provides a robust framework for scientists aiming to dissect the nuanced interactions within the JAK-STAT pathway and identify novel therapeutic targets, particularly in conditions where JAK3 is dysregulated.

Biotin-dPEG®12-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®12-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Elamipretide TriTFA, a tetrapeptide, targets mitochondria, associates with cardiolipin, studied for treating Leber's Optic Neuropathy.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F3 antibody, catalog no. 70R-6807

Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 395-430 peptide. SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.

Peptide H-NDSGTYLCGAISLAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NDSGTYLCGAISLAPK-OH include the following: Recombinant expression and purification of extracellular domain of the programmed cell death protein receptor A Zhansaya, M Kanatbek, T Kanat - of Biochemistry & , 2020 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC7275830/

Peptide H-AVLVDLEPGTMDSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVLVDLEPGTMDSVR^-OH include the following: A fossil protein chimera; difficulties in discriminating dinosaur peptide sequences from modern cross-contamination M Buckley , S Warwood - of the Royal , 2017 - royalsocietypublishing.orghttps://royalsocietypublishing.org/doi/abs/10.1098/rspb.2017.0544 Mass Spectrometry Reveals New Insights into the Production of Superoxide Anions and 4-Hydroxynonenal Adducted Proteins in Human Sperm JK Netherton , L Hetherington, RA Ogle - , 2020 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201900205

H-Val-Val-Val-OH is an enantiomer of H-Val-Gly-Thr-Phe, a linear model of the apical region of the Caco2 cell. It is also a monolayer that has hydrogen bonds with other molecules. Molecular modeling shows that H-Val-Val-Val-OH inhibits the uptake of glucose by Caco2 cells. The transport properties of this molecule are not well understood, but it may inhibit glucose transport in the small intestine by binding to glucose transporter 2 (GLUT2). Chromatographic methods have been used to analyze H-Val-Val-Val-OH and its inhibition on growth factor activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of PPIB antibody, catalog no. 70R-7220

Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RGDNNL^TRIVGGQE-OH include the following: Detection and differentiation of active and inactive isoforms of coagulation factors II, VII, IX, and X in prothrombin complex concentrate by mass spectrometry C Wilhelm, ST Kiessig, M Mandago, S Wittke - Journal of Pharmaceutical , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708521005860

Peptide Ac-SGQGSFQPSQQN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-SGQGSFQPSQQN-NH2 include the following: Cutting edge: selective deamidation by tissue transglutaminase strongly enhances gliadin-specific T cell reactivity Y van de Wal, Y Kooy, P van Veelen - The Journal of , 1998 - journals.aai.orghttps://journals.aai.org/jimmunol/article/161/4/1585/31243 Cutting Edge: Selective Deamidation by TTS Enhances - J Immunol, 1998 - researchgate.nethttps://www.researchgate.net/profile/Amado-Salvador-Pena/publication/13573333_Cutting_Edge_Selective_Deamidation_by_Tissue_Transglutaminase_Strongly_Enhances_Gliadin-Specific_T_Cell_Reactivity1/links/0046351ecffca270f6000000/Cutting-Edge-Selective-Deamidation-by-Tissue-Transglutaminase-Strongly-Enhances-Gliadin-Specific-T-Cell-Reactivity1.pdf Cutting Edge: Selective Deamidation by Tissue TS Enhances - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=92a2f400a30214ca0e3d461699a7e9803fa304c6 Identification of Immunodominant Epitopes SA Troncone, RA Siciliano, MM Gaita, O Fierro - J , 2005 - researchgate.nethttps://www.researchgate.net/profile/Mauro-Rossi/publication/7429355_Identification_of_Immunodominant_Epitopes_of_-Gliadin_in_HLA-DQ8_Transgenic_Mice_following_Oral_Immunization/links/57a08b4908aece1c7218d989/Identification-of-Immunodominant-Epitopes-of-Gliadin-in-HLA-DQ8-Transgenic-Mice-following-Oral-Immunization.pdf Identification of immunodominant epitopes of alpha-gliadin in HLA-DQ8 transgenic mice following oral immunization S Senger, F Maurano , MF Mazzeo , M Gaita - The Journal of , 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/175/12/8087/73123 HLA-DQ determines the response to exogenous wheat proteins: a model of gluten sensitivity in transgenic knockout mice KE Black, JA Murray, CS David - The Journal of Immunology, 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/169/10/5595/35603 Structure of celiac disease-associated HLA-DQ8 and non-associated HLA-DQ9 alleles in complex with two disease-specific epitopes AK Moustakas , Y van de Wal, J Routsias - International , 2000 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/12/8/1157/670645

Peptide H-LLLEYLEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLLEYLEEK^-OH include the following: An i-type lysozyme from the Asiatic hard clam Meretrix meretrix potentially functioning in host immunity X Yue, B Liu, Q Xue - Fish & shellfish immunology, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1050464810003645 Metabolic engineering of Clostridium cellulolyticum for the production of n-butanol from crystalline cellulose SM Gaida, A Liedtke, AHW Jentges, B Engels - Microbial cell , 2016 - Springerhttps://link.springer.com/article/10.1186/s12934-015-0406-2 Quartet protein reference materials and datasets for multi-platform assessment of label-free proteomics S Tian, D Zhan , Y Yu, Y Wang, M Liu, S Tan, Y Li - Genome Biology, 2023 - Springerhttps://link.springer.com/article/10.1186/s13059-023-03048-y A targeted proteomic strategy for the measurement of oral cancer candidate biomarkers in human saliva R Kawahara, JG Bollinger, C Rivera , ACP Ribeiro - , 2016 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201500224 The new landscape of differentially expression proteins in placenta tissues of gestational diabetes based on iTRAQ proteomics L Ge, P Huang, H Miao, H Yu, D Wu, F Chen, Y Lin - Placenta, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0143400422004696 Selecting optimal peptides for targeted proteomic experiments in human plasma using in vitro synthesized proteins as analytical standards JG Bollinger, AB Stergachis , RS Johnson - Proteomics by Mass , 2016 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-3524-6_12 High-throughput absolute quantification of proteins using an improved two-dimensional reversed-phase separation and quantification concatemer (QconCAT) J Wei, C Ding, J Zhang, W Mi, Y Zhao, M Liu - Analytical and , 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-7784-x A new sample preparation method for the absolute quantitation of a target proteome using 18 O labeling combined with multiple reaction monitoring mass J Li, L Zhou, H Wang, H Yan, N Li, R Zhai, F Jiao - Analyst, 2015 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2015/an/c4an02092h Analysis of peroxynitrite-mediated post-translational modifications of caveolin-1 HJ Warshakoon - 2006 - search.proquest.comhttps://search.proquest.com/openview/d5e2797aa9ebe8daa7e9253a06995e4b/1?pq-origsite=gscholar&cbl=18750&diss=y Affinity-based biosensors, microarrays and proteomics E Nice , B Catimel - Proteome analysis, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780444510242500278 The integration of SPR biosensors with mass spectrometry: possible applications for proteome analysis C Williams, TA Addona - Trends in Biotechnology, 2000 - cell.comhttps://www.cell.com/trends/biotechnology/fulltext/S0167-7799(99)01389-X The use of biosensors for microaffinity purification: an integrated approach to proteomics B Catimel, J Rothacker, E Nice - Journal of biochemical and biophysical , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165022X01002056 Rapid empirical discovery of optimal peptides for targeted proteomics AB Stergachis , B MacLean , K Lee - Nature , 2011 - nature.comhttps://www.nature.com/articles/nmeth.1770 Global measurements of human transcription factor occupancy: Insights into development and genome evolution AB Stergachis - 2013 - digital.lib.washington.eduhttps://digital.lib.washington.edu/researchworks/handle/1773/23454

Peptide H-GEAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GEAGPQGPR^-OH include the following: TABLA SUPLEMENTARIA S1. Control de contaminacion humana en el procesamiento de las muestras CS Modificaciones, A WELLQQVDTSTR - SciELO Argentinahttp://www.scielo.org.ar/pdf/raab/v25n1/1514-7991-raab-25-01-e062-suppl2.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP4 antibody, catalog no. 70R-2238

Please enquire for more information about H-Ile-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-GGVGSPPPLTQEEAAAAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GGVGSPPPLTQEEAAAAAR-OH include the following: Targeted proteomic analysis dataset of archival core human kidney biopsies to investigate the biology of hypertensive nephropathy G Barkas, M Makridakis, H Gakiopoulou , D Vlahakos - Data in Brief, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2352340922000178

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRR1 antibody, catalog no. 70R-5215

Elamipretide TFA (RX-31 TFA) is a cardiolipin peroxidase inhibitor and mitochondria-targeting peptide[1].

A synthetic peptide for use as a blocking control in assays to test for specificity of AGBL5 antibody, catalog no. 70R-1956

Peptide H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KKKKKKWLGSALIGALLPSVVGLFQ-NH2 include the following: Interaction of designed cationic antimicrobial peptides with the outer membrane of gram-negative bacteria S He, CM Deber - Scientific Reports, 2024 - nature.comhttps://www.nature.com/articles/s41598-024-51716-1

A synthetic peptide for use as a blocking control in assays to test for specificity of PSPH antibody, catalog no. 70R-4330

Peptide H-VGGTGMFTVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGGTGMFTVR-OH include the following: Uromodulin exclusion list improves urinary exosomal protein identification TF Hiemstra, PD Charles, SS Hester - Journal of , 2011 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3221452/ Urine haptoglobin levels predict early renal functional decline in patients with type 2 diabetes NM Bhensdadia, KJ Hunt, MF Lopes-Virella - Kidney international, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0085253815558869

A synthetic peptide for use as a blocking control in assays to test for specificity of ARF1 antibody, catalog no. 70R-8783

IGF1 N15 Human is a desiccated, freeze-dried protein that is stable isotope and suitable for use in metabolic studies. IGF1 N15 Human has the same amino acid sequence as human insulin-like growth factor 1 (IGF1). IGF1 N15 Human can be used to study cell proliferation, sulfation, and sulfate conjugation. This protein is also used in Cytokines research as an alternative to recombinant human IGF1. Reconstitute with water or buffer prior to use.

Peptide H-FLSFCSLFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLSFCSLFL-OH include the following: Screening and structure-based modeling of T-cell epitopes of Marburg virus NP, GP and VP40: an immunoinformatic approach for designing peptide-based vaccine. AK Ajay Kumar , AJ Amisha Jain, S Shraddha - 2013 - cabidigitallibrary.orghttps://www.cabidigitallibrary.org/doi/full/10.5555/20133257077

Fmoc-D-Asp(OtBu)-OH is a cell biology research tool that can be used to study protein interactions and ion channels. It also has been used as an inhibitor for the activation of receptor tyrosine kinases, including human epidermal growth factor receptor 2 (HER2) in breast cancer cells. Fmoc-D-Asp(OtBu)-OH is a high purity compound that is available with CAS No. 112883-39-3.

Peptide Ac-TRDIYETDYYRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-TRDIYETDYYRK-NH2 include the following: Highly efficient and selective enrichment of phosphopeptides using porous anodic alumina membrane for MALDI-TOF MS analysis Y Wang, W Chen , J Wu, Y Guo - Journal of the American , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1016/j.jasms.2007.04.014 N-Terminal peptide labeling strategy for incorporation of isotopic tags: A method for the determination of site-specific absolute phosphorylation stoichiometry X Zhang, QK Jin, SA Carr - Rapid Communications in , 2002 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.864 Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns (3, 4) P2-binding adaptor protein TAPP1 WA Kimber, M Deak, AR Prescott - Biochemical , 2003 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/376/2/525/40933 Phosphopeptide analysis by directly coupling two-dimensional planar electrochromatography/thin-layer chromatography with matrix-assisted laser desorption V Panchagnula , A Mikulskis, L Song, Y Wang - of Chromatography A, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967307006644 Activation of insulin signal transduction pathway and anti-diabetic activity of small molecule insulin receptor activators SA Qureshi, V Ding, Z Li, D Szalkowski - Journal of Biological , 2000 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)88554-8/abstract A bacterial phosphatase-like enzyme of the malaria parasite Plasmodium falciparum possesses tyrosine phosphatase activity and is implicated in the regulation of S Fernandez-Pol, Z Slouka , S Bhattacharjee - Eukaryotic , 2013 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/ec.00027-13 Inhibition of the activity of protein tyrosine phosphatase 1C by its SH2 domains R Townley, SH Shen, D Banville - Biochemistry, 1993 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/bi00212a006 Oxidation of tyrosine-phosphopeptides by titanium dioxide photocatalysis M Ruokolainen, E Ollikainen, T Sikanen - Journal of the , 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.6b02472 Imitation of biologically relevant oxidation reactions by titanium dioxide photocatalysis M Ruokolainen - 2017 - helda.helsinki.fihttps://helda.helsinki.fi/bitstreams/70e2dfb3-2919-450a-b634-207b8b0b484c/download The insulin-dependent tyrosine protein kinase substrate specificity and regulation by cyclic-AMP LANN STADTMAUER - 1987 - repository.yu.eduhttps://repository.yu.edu/handle/20.500.12202/3162 Nanodiamond-based two-step sampling of multiply and singly phosphorylated peptides for MALDI-TOF mass spectrometry analysis KJ Shiau, SU Hung, HW Lee, CC Wu - Analyst, 2011 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2011/an/c0an01046d Gas-phase ion unimolecular dissociation for rapid phosphopeptide mapping by IRMPD in a penning ion trap: An energetically favored process JW Flora, DC Muddiman - Journal of the American Chemical , 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja0261170 Selective, sensitive, and rapid phosphopeptide identification in enzymatic digests using ESI-FTICR-MS with infrared multiphoton dissociation JW Flora, DC Muddiman - Analytical chemistry, 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac010333u Decrease in beta-subunit phosphotyrosine correlates with internalization and activation of the endosomal insulin receptor kinase. JW Burgess, I Wada, N Ling, MN Khan - Journal of Biological , 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925819502022 NMR analysis of regioselectivity in dephosphorylation of a triphosphotyrosyl dodecapeptide autophosphorylation site of the insulin receptor by a catalytic fragment of JP Lee, H Cho, W Bannwarth, EA Kitas - Protein , 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/pro.5560011015 Energy dependence of HCD on peptide fragmentation: stepped collisional energy finds the sweet spot JK Diedrich, AFM Pinto, JR Yates III - Journal of the American , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1007/s13361-013-0709-7 Enzymatic Phosphorylation of Oxidized Tyrosine Residues J Heininen, C Erbacher, T Kotiaho - Journal of Proteome , 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.3c00061 On-line amino acid-based capillary isoelectric focusing-ESI-MS/MS for protein digests analysis G Zhu, L Sun, P Yang, NJ Dovichi - Analytica chimica acta, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267012006216 Automated high throughput multiple target screening of molecular libraries by microfluidic MALDI-TOF MS F Hsieh, H Keshishian, C Muir - Journal of Biomolecular , 1998 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/108705719800300305 Rapid separation of phosphopeptides by microchip electrophoresis-electrospray ionization mass spectrometry E Ollikainen, A Bonabi , N Nordman, V Jokinen - of Chromatography A, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967316302084 Sebastian Fernandez-Pol, Zdenek Slouka, Souvik AA Holder , E Campanella, PS Low , N Bhattacharjee - Eukaryotic , 2013 - academia.eduhttps://www.academia.edu/download/70477545/A_bacterial-like_phosphatase_of_malaria_20210928-22496-1ty0rgd.pdf

Peptide H-A^^^PG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-A^^^PG-OH include the following: Binding of a membrane proteoglycan from Klebsiella pneumoniae and its derivatives to human leukocytes Z Hmama, G Normier, E Kouassi, M Flacher, H Binz - Immunobiology, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0171298511802494 Role of acyl residues in polyclonal murine B cell activation by acylpoly (1, 3) galactosides from Klebsiella pneumoniae. Z Hmama, G Lina, G Normier, H Binz - Journal of immunology , 1993 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/151/10/5440/27696 Antibacterial effect of autologous platelet-rich gel derived from health volunteers in vitro Y Yang, H Liu, G Liu, X Ran - Zhongguo xiu fu chong jian wai ke za , 2010 - europepmc.orghttps://europepmc.org/article/med/20540263 The targeted development of collagen-active peptides based on composite enzyme hydrolysis: a study on the structure-activity relationship X Hu, Y Yang, C Chang, J Li, Y Su, L Gu - Food & Function, 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2023/fo/d3fo04455f In Vitro and In Silico Studies on Angiotensin I-Converting Enzyme Inhibitory Peptides Found in Hydrophobic Domains of Porcine Elastin T Hatakenaka, T Kato, K Okamoto - Molecules, 2023 - mdpi.comhttps://www.mdpi.com/1420-3049/28/8/3337 Isolation and charaterization of bioactive peptides from hwangtae (yellowish dried alaska pollack) protein hydrolysate SS Cho, HK Lee, CY Yu, MJ Kim - Nutrition and Food , 2008 - koreascience.krhttps://koreascience.kr/article/JAKO200828955288452.page Use of a Poly-γ-Glutamic Acid-Derived Amphipathic Polypeptide for the Reconstitution of Membrane Proteins. SG Han , SB Choi, NH Kim, S Kang - Bulletin of the Korean , 2020 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=02532964&asa=N&AN=144222090&h=jfCRFIHuB0TCI6xz%2BxRL0KToYki9Nj3zOPRGrV%2BOxDx5SC6SUXwtcW91nLoxGcbreFlvICVuu5MSQKFG1TQxLw%3D%3D&crl=c An amphipathic polypeptide derived from poly-γ-glutamic acid for the stabilization of membrane proteins SG Han , JH Na , WK Lee , D Park, J Oh - Protein , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/pro.2575 Fluorous Peptide Nucleic Acids: PNA Analogues with Fluorine in Backbone (γ-CF2-apg-PNA) Enhance Cellular Uptake S Ellipilli , KN Ganesh - The Journal of organic chemistry, 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.joc.5b01614 Cationic Antimicrobial Peptides have Reduced Binding to MprF-Modified Membranes PW Simcock, MS Sansom , PJ Stansfeld , M Bublitz - Biophysical , 2020 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(19)32331-8.pdf PGAIPG, a repeated hexapeptide of bovine tropoelastin, is a ligand for the 67-kDa bovine elastin receptor LE Grosso, M Scott - Matrix, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0934883211800740 Single-Crystal Studies of Peptide Prolyl and Glycyl 15N Shielding Tensors KW Waddell, EY Chekmenev - Journal of the American , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja044204h Conformational change of the triple-helical structure. II. Conformation of (Pro-Pro-Gly)n and (Pro-Pro-Gly)n(Ala-Pro-Gly)m(Pro-Pro-Gly)n in an aqueous K Sutoh, H Noda - Biopolymers: Original Research on , 1974 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.1974.360131118 Apg-2 has a chaperone-like activity similar to Hsp110 and is overexpressed in hepatocellular carcinomas K Gotoh, K Nonoguchi, H Higashitsuji, Y Kaneko - FEBS letters, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579304000341 Effects of alkyl polyglycoside (APG) on Bombyx mori silk degumming and the mechanical properties of silk fibroin fibre F Wang, YQ Zhang - Materials Science and Engineering: C, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0928493117304629 Aminopropyl glass and its p-phenylene diisothiocyanate derivative, a new support in solid-phase Edman degradation of peptides and proteins E Wachter, W Machleidt, H Hofner, J Otto - FEBS letters, 1973 - core.ac.ukhttps://core.ac.uk/download/pdf/81200622.pdf The sequence of an atriopeptigen: a precursor of the bioactive atrial peptides DM Gelher, MG Currie , NR Siegel, KF Fok - Biochemical and , 1984 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0006291X84907496 Arginine selective reagents for ligation to peptides and proteins DA Thompson , R Ng, PE Dawson - Journal of Peptide Science, 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.2867 Molecular architecture of secretin receptors: The specific covalent labelling of a 51 kDa peptide after cross-linking of [125I]iodo-secretin to intact rat pancreatic acini D Gossen, P Poloczek, M Svoboda , J Christophe - FEBS letters, 1989 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1016/0014-5793(89)80130-9 Evaluation of alkyl polyglucoside as an alternative surfactant in the preparation of peptide-loaded nanoparticles AR Patel , S Kulkarni, TD Nandekar - Journal of , 2008 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/02652040802075526 Synthesis and self-assembly of amphiphilic precision glycomacromolecules A Banger, J Sindram, M Otten, J Kania, D Wilms - Polymer , 2021 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2021/py/d1py00422k

Peptide H-MDVTSQARGVGLEMYPGTAQPAAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MDVTSQARGVGLEMYPGTAQPAAC-OH include the following: G protein-coupled estrogen receptor-selective ligands modulate endometrial tumor growth WK Petrie, MK Dennis, C Hu, D Dai - Obstetrics and , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2013/472720 GPR30: a novel indicator of poor survival for endometrial carcinoma HO Smith, KK Leslie, M Singh, CR Qualls - American journal of , 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0002937807000051

This Neuroendocrine Regulatory Peptide-1 (rat) product can be used as an endogenous suppressor of vasopressin release and is available as a 0.1mg vial. The neuroendocrine regulatory peptide-1 (NERP1) is derived from VGF and it colocalizes with vasopressin in the hypothalamus and it has been found that NERPs prevent vasopressin release from the hypothalamus. Thus NERP1 is involved in body fluid homeostasis through modulating the release of vasopressin.

A synthetic peptide for use as a blocking control in assays to test for specificity of RPLP0 antibody, catalog no. 70R-1442

A synthetic peptide for use as a blocking control in assays to test for specificity of NOL4 antibody, catalog no. 70R-4720

Ac-Asp-Glu-Val-Asp-AMC ammonium salt is a small molecule that is used as a tool to study apoptosis in vitro. Ac-Asp-Glu-Val-Asp-AMC ammonium salt induces apoptosis by blocking the mitochondrial membrane potential and inducing the release of cytochrome c from mitochondria into the cytoplasm. This drug also induces activation of caspase 3, which initiates the cascade of events leading to cell death. Ac-Asp-Glu-Val-Asp-AMC ammonium salt has been shown to have an antiangiogenic effect on hl60 cells. This effect may be due to its ability to inhibit expression of survivin, a protein that protects cells from apoptosis. The efficacy of this drug in an experimental model has been shown to be dependent on toll like receptor (TLR) signaling pathways and mitochondrial function.br>

Peptide Biot-GRSRSRSRSRSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Biot-GRSRSRSRSRSR-NH2 include the following: Synthesis of N, N0-bis (5-arylidene-4-oxo-3, 5-dihydro-4H-imidazol-2-yl) diamines bearing various linkers and biological evaluation as potential inhibitors of WK Coulibalya, L Paquin, A Benie - European Journal of , 2012 - academia.eduhttps://www.academia.edu/download/45427486/Synthesis_of_NN_-bis5-arylidene-4-oxo-20160507-15074-3kxdr4.pdf Synthesis and biological evaluation of Haspin inhibitors: Kinase inhibitory potency and cellular activity W Zeinyeh, YJ Esvan, B Josselin, M Defois - European Journal of , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523422002719 Combined virtual and experimental screening for CK1 inhibitors identifies a modulator of p53 and reveals important aspects of in silico screening performance V Myrianthopoulos , O Lozach , D Zareifi - International Journal of , 2017 - mdpi.comhttps://www.mdpi.com/1422-0067/18/10/2102 Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid T Tahtouh , JM Elkins, P Filippakopoulos - Journal of medicinal , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm301034u Structure-based virtual screening, biological assessment, and MD simulation studies of novel CNS compatible GSK-3beta inhibitors as potential Alzheimer's disease S Sukanya, BS Choudhary , P Mehta, S Filipek , R Malik - 2022 - researchsquare.comhttps://www.researchsquare.com/article/rs-1309750/latest Library-based discovery of DYRK1A/CLK1 inhibitors from natural product extracts P Grabher, E Durieu, E Kouloura, M Halabalaki - Planta , 2012 - thieme-connect.comhttps://www.thieme-connect.com/products/ejournals/html/10.1055/s-0031-1298625 Solene Guiheneuf, Ludovic Paquin, Franaca§ois Carreaux, Emilie Durieu, Thierry Roisnel, Laurent Meijer & Jean P Bazureau - Mol Divers, 2014 - researchgate.nethttps://www.researchgate.net/profile/Laurent-Meijer/publication/260445612_New_5-ylidene_rhodanine_derivatives_based_on_the_dispacamide_A_model/links/00b7d53a74286cb95a000000/New-5-ylidene-rhodanine-derivatives-based-on-the-dispacamide-A-model.pdf In vitro identification of imidazo [1, 2-a] pyrazine-based antileishmanial agents and evaluation of L. major casein kinase 1 inhibition MA Bazin, S Cojean , F Pagniez, G Bernadat - European Journal of , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523420309284 Discovery of novel (imidazo [1, 2-a] pyrazin-6-yl) ureas as antiproliferative agents targeting P53 in non-small cell lung cancer cell lines MA Bazin, B Rousseau , S Marhadour - Anticancer , 2016 - ar.iiarjournals.orghttps://ar.iiarjournals.org/content/36/4/1621.short Synthesis and Kinase Inhibitory Potencies of Pyrazolo[3,4-g]isoquinolines M Defois, C Remondin, B Josselin, L Nauton , V Thery - Molecules, 2022 - mdpi.comhttps://www.mdpi.com/1420-3049/27/17/5578 Synthesis and biological evaluation of 1H-pyrrolo [3, 2-g] isoquinolines M Defois, B Josselin, P Brindeau, A Kramer - Bioorganic & Medicinal , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0968089624000336 New pyrido [3, 4-g] quinazoline derivatives as CLK1 and DYRK1A inhibitors: synthesis, biological evaluation and binding mode analysis H Tazarki, W Zeinyeh, YJ Esvan, S Knapp - European Journal of , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S022352341930056X Chemical synthesis and biological validation of immobilized protein kinase inhibitory Leucettines G Burgy, T Tahtouh , E Durieu, B Foll-Josselin - European Journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0223523413000639 Synthesis and biological studies of new quinazolines with ether functions in position 2 D Brahmaiah, AKD Bhavani, P Aparna - -Online Journal of , 2019 - univ-rennes.hal.sciencehttps://univ-rennes.hal.science/hal-02161844/ Structure Activity Relationship Studies around DB18, a Potent and Selective Inhibitor of CLK Kinases D Brahmaiah, AKD Bhavani, P Aparna , NS Kumar - Molecules, 2022 - mdpi.comhttps://www.mdpi.com/1420-3049/27/19/6149 New quinoxaline derivatives as dual Pim-1/2 kinase inhibitors: Design, synthesis and biological evaluation B Oyallon, M Brachet-Botineau, C Loge, T Robert - Molecules, 2021 - mdpi.comhttps://www.mdpi.com/1420-3049/26/4/867 Biological evaluation of arylsemicarbazone derivatives as potential anticancer agents ACN da Cruz, DJ Brondani, I Temaca­stocles - , 2019 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6958387/ Biological evaluation of arylsemicarbazone derivatives as potential anticancer agents AC Nascimento da Cruz, DJ Brondani - Pharmaceuticals, 2019 - mdpi.comhttps://www.mdpi.com/1424-8247/12/4/169

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-QPR^GRILGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QPR^GRILGGQE-OH include the following: Essential role of mannose-binding lectin-associated serine protease-1 in activation of the complement factor D M Takahashi, Y Ishida, D Iwaki, K Kanno - Journal of Experimental , 2010 - rupress.orghttps://rupress.org/jem/article-abstract/207/1/29/40522 The role of MASP-1/3 in complement activation H Sekine, M Takahashi, D Iwaki, T Fujita - Complement Therapeutics, 2013 - Springerhttps://link.springer.com/chapter/10.1007/978-1-4614-4118-2_3

Peptide H-NKSKKKAQQAAADTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NKSKKKAQQAAADTG-OH include the following: Dai et al. 10.1073/pnas. 0911742106 I Multiparameter - authors.library.caltech.eduhttps://authors.library.caltech.edu/17005/2/Dai2009p6545P_Natl_Acad_Sci_Usa_supp.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of CASD1 antibody, catalog no. 70R-7436

Peptide H-SHLTTGGDVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SHLTTGGDVR-OH include the following: Quantification of ricin, RCA and comparison of enzymatic activity in 18 Ricinus communis cultivars by isotope dilution mass spectrometry SM Prezioso, AJ Carter, YM Williamson, SC McGrath - Toxicon, 2015 - researchgate.nethttps://www.researchgate.net/profile/David-Schieltz/publication/270595184_Quantification_of_Ricin_RCA_and_Comparison_of_Enzymatic_Activity_in_18_Ricinus_Communis_Cultivars_by_Isotope_Dilution_Mass_Spectrometry/links/54bcedaf0cf253b50e2d85ff/Quantification-of-Ricin-RCA-and-Comparison-of-Enzymatic-Activity-in-18-Ricinus-Communis-Cultivars-by-Isotope-Dilution-Mass-Spectrometry.pdf Quantification of ricin, RCA and comparison of enzymatic activity in 18 Ricinus communis cultivars by isotope dilution mass spectrometry DM Schieltz, LG McWilliams, Z Kuklenyik, SM Prezioso - Toxicon, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0041010115000069

T regulatory cell epitopes (Tregitopes) are a set of natural T cell epitopes derived from immunoglobulin G. These peptides are Treg-activating and show some promise in prophylactic and therapeutic studies in type 1 diabetes mellitus: which is associated with effector T cell (Teff) destruction of insulin-producing pancreatic β-islet cells. In non-diabetics, self-reactive T cells are deleted during thymic development, rendered anergic, or converted into natural regulatory T cells (Tregs) that suppress autoimmune responses.Tregitopes are processed and presented by MHC class II molecules. They can suppress effector T cell responses, and up-regulate Treg-associated cytokines and chemokines. Tregitopes help stimulate 'antigen-specific adaptive tolerance induction' (ASATI) to modulate antigen-specific transplant rejection and to reduce immune responses to allergens in vitro and in vivo.

A synthetic peptide for use as a blocking control in assays to test for specificity of SIN3B antibody, catalog no. 70R-8939

A synthetic peptide for use as a blocking control in assays to test for specificity of MOS antibody, catalog no. 70R-5628

Peptide H-VMNILLQYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VMNILLQYV-OH include the following: Human thymopoiesis produces polyspecific CD8+ alpha/beta T cells responding to multiple viral antigens V Quiniou, P Barennes, V Mhanna, P Stys - Elife, 2023 - elifesciences.orghttps://elifesciences.org/articles/81274 Identification of GAD65 AA 114-122 reactive'memory-like'NK cells in newly diagnosed Type 1 diabetic patients by HLA-class I pentamers V Perri, E Gianchecchi , L Cifaldi , M Pellegrino - Plos one, 2017 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0189615 Islet transplantation in patients with autoimmune diabetes induces homeostatic cytokines that expand autoreactive memory T cells P Monti, M Scirpoli, P Maffi, N Ghidoli - The Journal of , 2008 - Am Soc Clin Investighttps://www.jci.org/articles/view/35197 Detection of GAD65 autoreactive T-cells by HLA class I tetramers in type 1 diabetic patients L Giuliani, R Mele, M Di Giovine, L Altieri - BioMed Research , 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/full/10.1155/2009/576219

Peptide H-LLQQFPLDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLQQFPLDLEK-OH include the following: Orthogonal analysis of dystrophin protein and mRNA as a surrogate outcome for drug development K Uaesoontrachoon, S Srinivassane - Biomarkers in , 2019 - Future Medicinehttps://www.futuremedicine.com/doi/abs/10.2217/bmm-2019-0242

HBTU is a reagent that is used in the synthesis of peptides. It has been shown to have inhibitory properties and stable complexes with ester linkages. HBTU has been shown to have a negative effect on congestive heart disease, which may be due to its ability to bind to receptors and mimic the effects of peptide hormones. This compound is also used as a model system for mitochondrial membrane potential. HBTU binds covalently to the peptide hormone receptor, which slows down the rate of degradation and increases its resistance to proteases. HBTU can also be used as an immunosuppressant drug in animal models of autoimmune diseases by inhibiting T-cell proliferation and cytokine production.

H-Lys-Val-Pro-Arg-Asn-Gln-Asp-Trp-Leu-OH is a peptide that was derived from the human HGP1 protein. The peptide, which is MHC class I restricted, has been shown to have an epitope that is recognized by CD8+ T cells in mice. This peptide has also been shown to be biologically active and heteroclitic.

A synthetic peptide for use as a blocking control in assays to test for specificity of THNSL2 antibody, catalog no. 70R-4062

A synthetic peptide for use as a blocking control in assays to test for specificity of LRP8 antibody, catalog no. 70R-7376

A synthetic peptide for use as a blocking control in assays to test for specificity of NPHP1 antibody, catalog no. 70R-6036

FRETS-25Ile is a peptide that belongs to the class of activators. It has been shown to activate an antibody against the beta2 adrenergic receptor and can be used for research purposes. FRETS-25Ile is a high purity product with an ion channel inhibitor activity. The CAS number for this product is 69710-51-5.

Peptide H-FALALKALKKALKKLKKALKKAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FALALKALKKALKKLKKALKKAL-OH include the following: Conjugates of Vancomycin and Cell-penetrating Peptides-New Weapons in the Armoury against Drug Resistant Bacteria SJ Tzotzos - academia.eduhttps://www.academia.edu/download/80111698/Tzotzos_Jun_2019.pdf Nanoparticles suitable for BCAA isolation can serve for use in magnetic lipoplex-based delivery system for L, I, V, or R-rich antimicrobial peptides R Vesely, P Jelinkova, D Hegerova, N Cernei, P Kopel - Materials, 2016 - mdpi.comhttps://www.mdpi.com/1996-1944/9/4/260 A conjugate of the lytic peptide Hecate and gallic acid: structure, activity against cervical cancer, and toxicity PRS Sanches, BM Carneiro, MN Batista , ACS Braga - Amino Acids, 2015 - Springerhttps://link.springer.com/article/10.1007/s00726-015-1980-7 Estudo do peptaca­deo laca­tico Hecate e sua conjugaaca§aca£o com acido galico: atividade contra o carcinoma cervical humano, mecanismo de aaca§aca£o e toxicidade PRS Sanches - 2016 - repositorio.unesp.brhttps://repositorio.unesp.br/items/f1c42ae7-7789-4eac-a26b-20a11f103568 Estudo do peptaca­deo laca­tico Hecate e sua conjugaaca§aca£o com acacido Galico: Atividade contra o carcinoma cervical humano, mecanismo de aaca§aca£o e toxicidade PR da Silva Sanches - 2016 - repositorio.unesp.brhttps://repositorio.unesp.br/server/api/core/bitstreams/28c2fb46-4db8-4952-a85f-1a6694d7afda/content Novel vancomycin-peptide conjugate as potent antibacterial agent against vancomycin-resistant Staphylococcus aureus P Jelinkova, Z Splichal, AMJ Jimenez - Infection and drug , 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.2147/IDR.S160975 Real-time visualization of cell membrane damage using gadolinium-schiff base complex-doped quantum dots A Moulick , Z Heger , V Milosavljevic - applied materials & , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsami.8b15868

Peptide LCBiot-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-LMKNMDPLNDNV-NH2 include the following: Natural IgM blockade limits infarct expansion and left ventricular dysfunction in a swine myocardial infarct model S Sihag, MS Haas, KM Kim, JL Guerrero - Circulation , 2016 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/CIRCINTERVENTIONS.115.002547 Blockade of self-reactive IgM significantly reduces injury in a murine model of acute myocardial infarction MS Haas, EM Alicot, F Schuerpf, I Chiu - Cardiovascular , 2010 - academic.oup.comhttps://academic.oup.com/cardiovascres/article-abstract/87/4/618/321181 Myocardial Infarction MI Model - 2015 - Am Heart Assochttps://www.ahajournals.org/doi/download-pdf-zip/10.1161/CIRCINTERVENTIONS.115.002547 Attenuation of the effects of rat hemorrhagic shock with a reperfusion injury-inhibiting agent specific to mice C Ahmadi-Yazdi, B Williams , S Oakes, FD Moore Jr - Shock, 2009 - journals.lww.comhttps://journals.lww.com/shockjournal/fulltext/2009/09000/Transient_Receptor_Potential_Vanilloid_1.00011.aspx

JNK peptide inhibitor. Mimics JIP-1 residues 153-163. Micromolar affinity, little effect on p38, ERK.

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of ARID5A antibody, catalog no. 70R-9090

Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LPPYLFT-OMe include the following: Development of peptidomimetic inhibitors of the ERG gene fusion product in prostate cancer X Wang , Y Qiao , IA Asangani, B Ateeq , A Poliakov - Cancer cell, 2017 - cell.comhttps://www.cell.com/cancer-cell/pdf/S1535-6108(17)30060-0.pdf Emerging Developments in ETS-Positive Prostate Cancer Therapy GC Bowling, MG Rands, A Dobi, B Eldhose - Molecular Cancer Therapeutics, 2023 - AACRhttps://aacrjournals.org/mct/article-abstract/22/2/168/716254

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM55 antibody, catalog no. 70R-2822

Z-Leu-Leu-Leu-MCA is a peptide that is used as a research tool. It can be used to activate an antibody, or other cell surface receptor, by binding to the extracellular domain of the receptor. Z-Leu-Leu-Leu-MCA can also inhibit certain ion channels and ligand/receptor interactions. This peptide is highly pure and has CAS No. 152015-61-7.

Peptide H-AYLLPAPPAPGNASESEEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AYLLPAPPAPGNASESEEDR-OH include the following: Mass spectrometry-based detection and quantification of plasma glycoproteins using selective reaction monitoring YJ Kim, Z Zaidi-Ainouch, S Gallien, B Domon - nature protocols, 2012 - nature.comhttps://www.nature.com/articles/nprot.2012.023

Peptide H-FLRPGDDSSHDLMLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLRPGDDSSHDLMLLR-OH include the following: Bioinformatic strategies for unambiguous identification of prostate specific antigen in clinical samples aca Vegvari , M Rezeli , J Hakkinen , C Sihlbom - Journal of , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S187439191100265X