
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Products of "Peptides"
Sort by
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29
Custom research peptide; min purity 95%.Formula:C146H260N52O32Purity:Min. 95%Molecular weight:3,256.03 g/molH-DRVYIHPFH-NH2
Peptide H-DRVYIHPFH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DRVYIHPFH-NH2 include the following: Characterization of 4-hydroxy-2-nonenal-modified peptides by liquid chromatography-tandem mass spectrometry using data-dependent acquisition: Neutral loss N Rauniyar , SM Stevens Jr , K Prokai-Tatrai - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac802015m Isotope-coded dimethyl tagging for differential quantification of posttranslational protein carbonylation by 4-hydroxy-2-nonenal, an end-product of lipid peroxidation N Rauniyar , L Prokai - Journal of mass spectrometry, 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.1978 Mass spectrometry-based characterization of posttranslational modifications by 4-hydroxy-2-nonenal N Rauniyar - 2010 - search.proquest.comhttps://search.proquest.com/openview/abfc0f87ea5c81a5abd110a728406efc/1?pq-origsite=gscholar&cbl=18750 Dot immunobinding (DIB), enzyme-linked immunosorbent assay (ELISA), and radioimmunoassay (RIA) for detecting peptide antigens and specific antibodies E LAURITZEN, H FLYGE, A HOLM - Antibody techniques, 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780124664609500146 Development and validation of an ultra-sensitive method for the measurement of plasma renin activity in human plasma via LC-MS/MS DL Chappell, T McAvoy, B Weiss, R Weiner - Bioanalysis, 2012 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.12.268H-MGLIYNRM-OH
Peptide H-MGLIYNRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MGLIYNRM-OH include the following: Generation of a live attenuated influenza A vaccine by proteolysis targeting L Si , Q Shen, J Li, L Chen, J Shen, X Xiao, H Bai - Nature , 2022 - nature.comhttps://www.nature.com/articles/s41587-022-01381-4 Contemporary analysis of MHC-related immunodominance hierarchies in the CD8+ T cell response to influenza A viruses GT Belz , PG Stevenson, PC Doherty - The Journal of Immunology, 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/165/5/2404/33246 Chronic antigen stimulation alone is sufficient to drive CD8+ T cell exhaustion CM Bucks, JA Norton, AC Boesteanu - The Journal of , 2009 - journals.aai.orghttps://journals.aai.org/jimmunol/article/182/11/6697/78970H-AQDFVQWL^MNT-OH
Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AQDFVQWL^MNT-OH include the following: Glucagon-(19-29), a Ca2+ pump inhibitory peptide, is processed from glucagon in the rat liver plasma membrane by a thiol endopeptidase. P Blache , A Kervran, M Dufour, J Martinez - Journal of Biological , 1990 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)45769-9/abstractH-FVTVTAEALR^-OH
Peptide H-FVTVTAEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FVTVTAEALR^-OH include the following: Using Nanospray Liquid Chromatography and Mass Spectrometry to Quantitate Shiga Toxin Production in Environmental Escherichia coli Recovered from a Major CJ Silva, BG Lee, JC Yambao - Journal of agricultural , 2018 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jafc.8b05324 A proteomics assay to detect eight CBRN-relevant toxins in food B Gilquin, M Jaquinod , M Louwagie - , 2017 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201600357Prolactin Releasing Peptide (1-31), human
CAS:Human Prolactin Releasing Peptide (1-31) is a potent GPR10 agonist; Ki values are 1.03 nM (human) and 0.33 nM (rat).Formula:C160H252N56O42SPurity:98%Color and Shape:SolidMolecular weight:3664.15(2R,3R)-2-Amino-3-hydroxybutyric acid
CAS:Formula:C4H9NO3Purity:97%Color and Shape:SolidMolecular weight:119.1192H-Glu(Glu-OH)-OH
CAS:H-Glu(Glu-OH)-OH is a synthetic amino acid that is currently being investigated as a diagnostic agent for the detection of intracellular protein degradation by matrix metalloproteinase-9 (MMP-9). H-Glu(Glu-OH)-OH is taken up by cells in a concentration and time dependent manner, with an uptake rate of approximately 1.6 x 10^6 molecules per cell per hour. The uptake mechanism is not yet known, but has been hypothesized to be due to receptor binding. H-Glu(Glu-OH)-OH binds to cerebellar granule cells and alters mitochondrial metabolism, which may be related to its effects on the ubiquitin proteasome pathway. This compound also has diagnostic potential for atherosclerosis and glutamate transport disorders.Formula:C10H16N2O7Purity:Min. 95%Molecular weight:276.24 g/molH-NDEELNKLLGR-OH
Peptide H-NDEELNKLLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NDEELNKLLGR-OH include the following: Histones: a novel class of lipopolysaccharide-binding molecules LA Augusto, P Decottignies, M Synguelakis - Biochemistry, 2003 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0268394 Global turnover of histone post-translational modifications and variants in human cells BM Zee , RS Levin, PA DiMaggio , BA Garcia - Epigenetics & chromatin, 2010 - Springerhttps://link.springer.com/article/10.1186/1756-8935-3-22Histatin 5
CAS:Histatin 5, a human saliva peptide, blocks MMP-2 and MMP-9 at IC50s of 0.57/0.25 μM and kills fungi.Formula:C133H195N51O33Purity:98%Color and Shape:SolidMolecular weight:3036.29EXOC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC4 antibody, catalog no. 70R-2859Purity:Min. 95%Amyloid β Peptide (42-1)(human) acetate
Amyloid β Peptide (42-1)(human) acetate is the inactive form of Amyloid β Peptide (1-42).Purity:95.20%Color and Shape:SoildH-AIHELIQVMAELSPAAK^-OH
Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AIHELIQVMAELSPAAK^-OH include the following: Development of an on-line SPR-digestion-nanoLC-MS/MS system for the quantification and identification of interferon-γ in plasma ECA Stigter, GJ De Jong, WP Van Bennekom - Biosensors and , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0956566308006234CXCL16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL16 antibody, catalog no. 70R-6007Purity:Min. 95%MRPS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRPS2 antibody, catalog no. 70R-2423Purity:Min. 95%H-SGGGDLTLGLEPSEEEAPR-OH
Peptide H-SGGGDLTLGLEPSEEEAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SGGGDLTLGLEPSEEEAPR-OH include the following: Targeted proteomics for validation of biomarkers in clinical samples X Ye, J Blonder , TD Veenstra - Briefings in Functional Genomics , 2009 - academic.oup.comhttps://academic.oup.com/bfg/article-abstract/8/2/126/200832 Analysis of biofluids for biomarker research X Xu, TD Veenstra - PROTEOMICS-Clinical Applications, 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.200780173 The addition of FAIMS increases targeted proteomics sensitivity from FFPE tumor biopsies S Sweet , D Chain, W Yu, P Martin, M Rebelatto - Scientific Reports, 2022 - nature.comhttps://www.nature.com/articles/s41598-022-16358-1 High-Field Asymmetric Waveform Ion Mobility Spectrometry and Parallel Reaction Monitoring Increases Sensitivity for Clinical Biomarker Quantitation from Formalin S Sweet , D Chain, W Yu, P Martin, M Rebelatto - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.02.08.479554.abstract Challenges Remain in MS-Based Proteomic Analysis of Complex Biological Samples PF Dimond - Clinical OMICs, 2014 - liebertpub.comhttps://www.liebertpub.com/doi/full/10.1089/clinomi.01.12.06MHC II DRB1*03:01 Myoglobin 137-148
Myoglobin Myoglobin 137-148 MHC II DRB1*03:01 is a short part of Myoglobin. Myoglobin is protein which binds oxygen or also iron in the skeletal muscle tissue. Myoglobin 137-148 MHC II DRB1*03:01 Myoglobin 137-148 MHC II DRB1*03:01 is a classical peptide reference for the binding avec MHC II DRB1*03:01. Myoglobin 137-148 is often used to be in competition for study of the relative binding affinity.H-DFTYR^-OH
Peptide H-DFTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DFTYR^-OH include the following: Vasopressin, gonadal steroids and social recognition R Dantzer - Progress in brain research, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0079612308615848 DESIGN AND SYNTHESIS OF POTENT IN VIVO ANTAGONISTS OF OXYTOCIN K BANKOWSKI, M MANNING , J SETO - Journal of Peptide , 1980 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1980.tb02962.xH-MAERPEDLNLPNAVC-NH2
Peptide H-MAERPEDLNLPNAVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MAERPEDLNLPNAVC-NH2 include the following: TRAIP is a master regulator of DNA interstrand crosslink repair RA Wu, DR Semlow , AN Kamimae-Lanning - Nature, 2019 - nature.comhttps://www.nature.com/articles/s41586-019-1002-0ttpa-SGSG-OH
Peptide ttpa-SGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using ttpa-SGSG-OH include the following: Recent progress in supramolecular peptide assemblies as virus mimics for cancer immunotherapy Y Cai, W Ran, Y Zhai, J Wang, C Zheng, Y Li - Biomaterials , 2020 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2020/bm/c9bm01380f Epitopes of human brain acetylcholinesterase XM Zhang, G Liu, MJ Sun - Brain research, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006899300023945 Receptor-based identification of an inhibitory peptide against blood stage malaria X Li, H Chen, AA Khan, SB Lauterbach - Biochemical and , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X08017476 Synthetic Peptide Immunogens Elicit W Are - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=c994738bc12cf09b8e7231997cd305330adc8e14 Development of optimal bicistronic lentiviral vectors facilitates high-level TCR gene expression and robust tumor cell recognition S Yang, CJ Cohen , PD Peng, Y Zhao , L Cassard, Z Yu - Gene therapy, 2008 - nature.comhttps://www.nature.com/articles/gt200890 Nrf2 is controlled by two distinct beta-TrCP recognition motifs in its Neh6 domain, one of which can be modulated by GSK-3 activity S Chowdhry, Y Zhang , M McMahon , C Sutherland - Oncogene, 2013 - nature.comhttps://www.nature.com/articles/onc2012388 Identification of linear heparin-binding peptides derived from human respiratory syncytial virus fusion glycoprotein that inhibit infectivity RL Crim, SA Audet, SA Feldman, HS Mostowski - Journal of , 2007 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01226-06 Antigenicity in sheep of synthetic peptides derived from stress-regulated Mycobacterium avium subsp. paratuberculosis proteins and comparison with recombinant RB Gurung, DJ Begg, AC Purdie - Veterinary Immunology , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S016524271300161X Peptide-based ELISAs are not sensitive and specific enough to detect muscarinic receptor type 3 autoantibodies in serum from patients with Sjögren's syndrome N Roescher, A Kingman, Y Shirota - Annals of the , 2011 - ard.bmj.comhttps://ard.bmj.com/content/70/1/235.short Peptide-based ELISAs are not sensitive and specific enough to detect N Roescher, A Kingman, Y Shirota, JA Chiorini, GG Illei - 2011 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=f9498457f0c81838cc6a65200113c3c67bd1fd60 Peptide-based ELISAs are not sensitive and N Roescher, A Kingman, Y Shirota - 2010 - academia.eduhttps://www.academia.edu/download/48804898/Peptide-based_ELISAs_are_not_sensitive_a20160913-1527-14lsozf.pdf Identification of neutralizing and nonneutralizing epitopes in the porcine reproductive and respiratory syndrome virus GP5 ectodomain M Ostrowski , JA Galeota, AM Jar, KB Platt - Journal of , 2002 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.76.9.4241-4250.2002 Critical residues of epitopes recognized by several anti-p53 monoclonal antibodies correspond to key residues of p53 involved in interactions with the mdm2 protein JM Portefaix, S Thebault - Journal of , 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022175900002465 Screening and Characterization of Linear B-Cell Epitopes by Biotinylated Peptide Libraries I Rosenkrands, A Olsen - Peptide Antibodies: Methods and Protocols, 2015 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-2999-3_21 A Cys-Gly-Cys triad in the dehydrogenase region of Nox2 plays a key role in the interaction with p67phox I Dahan, SME Smith , E Pick - Journal of Leucocyte Biology, 2015 - academic.oup.comhttps://academic.oup.com/jleukbio/article-abstract/98/5/859/6935989 Mapping of Functional Domains in the p22phox Subunit of Flavocytochrome b 559 Participating in the Assembly of the NADPH Oxidase Complex by"Peptide Walking" I Dahan, I Issaeva, Y Gorzalczany, N Sigal - Journal of Biological , 2002 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)36447-6/abstract Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides HJ Park, SM Byun, YJ Ha, JS Ahn - Journal of Immunoassay , 1995 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/15321819508013556 From antigen uptake to immune modulation: the multifaceted potential of peptide nanofibers as vaccine nanocarriers HAFM Hassan , M Haider , SA Fahmy - Materials Advances, 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2024/ma/d4ma00075g Characterization and optimization of peptide arrays for the study of epitope-antibody interactions using surface plasmon resonance imaging GJ Wegner, HJ Lee, RM Corn - Analytical chemistry, 2002 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac025922u CD81 regulates cell migration through its association with Rac GTPase E Tejera, V Rocha-Perugini - Molecular biology of , 2013 - Am Soc Cell Biolhttps://www.molbiolcell.org/doi/abs/10.1091/mbc.E12-09-0642 UDP-GlcNAc: Ser-ProteinN-Acetylglucosamine-1-Phosphotransferase fromDictyostelium discoideum Recognizes Serine-containing Peptides and Eukaryotic Cysteine DP Mehta, JR Etchison, R Wu, HH Freeze - Journal of Biological Chemistry, 1997 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)38702-7/abstract Functional analysis of the antigen binding sites on the MTB/HIV-1 peptide bispecific T-cell receptor complementarity determining region 3alpha CY Zhou, RN Wang, WT He, DR Luo, SR Yuan, Q Wen - AIDS, 2023 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/2023/01010/Functional_analysis_of_the_antigen_binding_sites.4.aspx Characterization of the heparan sulfate and chondroitin sulfate assembly sites in CD44 B Greenfield, WC Wang, H Marquardt - Journal of Biological , 1999 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)88204-2/abstractH-LSVPTSEWQR-OH
Peptide H-LSVPTSEWQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSVPTSEWQR-OH include the following: Quantification of T cell binding polyclonal rabbit anti-thymocyte globulin in human plasma with liquid chromatography tandem-mass spectrometry ME Amrani, R Admiraal, L Willaert- The AAPS Journal, 2020 - Springerhttps://link.springer.com/article/10.1208/s12248-020-0419-6 Improved precision of proteomic measurements in immunoprecipitation based purifications using relative quantitation SM Rogstad, T Sorkina, A Sorkin, CC Wu - Analytical chemistry, 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac4002222 Peptide mapping and glycoanalysis of cancer cell-expressed glycoproteins CA215 recognized by RP215 monoclonal antibody G Lee, P Azadi - Journal of Carbohydrate Chemistry, 2012 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07328303.2011.626544H-QQFFGLM-NH2
Peptide H-QQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QQFFGLM-NH2 include the following: Molecular and genetic analyses of carboxy-terminal repeat domain mutants of Drosophila RNA polymerase II WJ Brickey - 1994 - search.proquest.comhttps://search.proquest.com/openview/7ab432f391ecf5892e9c58e68f1a7695/1?pq-origsite=gscholar&cbl=18750&diss=y Interaction of substance P with phospholipid bilayers: a neutron diffraction study JP Bradshaw, SMA Davies, T Hauss - Biophysical journal, 1998 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(98)77577-0.pdf The conformation of substance P in lipid environments DA Keire , TG Fletcher - Biophysical journal, 1996 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(96)79734-5.pdfATP1B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ATP1B1 antibody, catalog no. 70R-6360Purity:Min. 95%Larazotide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C32H55N9O10Molecular weight:725.83 g/molH-Orn-Orn-Orn-OH acetate salt
CAS:H-Orn-Orn-Orn-OH acetate salt is a chemical compound with the molecular formula C10H14O2. It is used as a building block in organic chemistry, often as an intermediate for the synthesis of other compounds, or as a reagent.Formula:C15H32N6O4Purity:Min. 95%Color and Shape:PowderMolecular weight:360.45 g/molAnti PACAP38, humanSerum
Anti PACAP38, humanSerum is a research tool that can be used to study the role of PACAP in various biological processes. The antibody is generated against human PACAP38 and has been shown to inhibit the activity of this peptide. The antibody also binds to the receptor for this peptide, which is a G protein-coupled receptor. This antibody can be used as an inhibitor of PACAP and its receptor in various cell types.Purity:Min. 95%Thyrotropin Releasing Hormone (TRH) (Human, Ovine, Porcine, Rat)
CAS:Thyrotropin Releasing Hormone (TRH) is a hormone that stimulates the release of thyroid hormones. TRH has been used to diagnose and treat conditions such as autoimmune diseases, infectious diseases, and thyroid disease. It is also used in the treatment of patients with hypothyroidism who are not responding to levothyroxine therapy. TRH is administered intravenously or intramuscularly. This drug is primarily used for diagnostic purposes in women who have symptoms of hyperthyroidism but normal serum levels of TSH and thyroxine levels. TRH administration can result in a rise in serum prolactin levels, which may be useful for diagnosis of the condition hyperprolactinemia.Formula:C16H22N6O4•H2OPurity:Min. 95%Molecular weight:380.4 g/molSNRP70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-4901Purity:Min. 95%Ac-CMQNPYSRHSSMPRPDY-OH
Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CMQNPYSRHSSMPRPDY-OH include the following: Improved in vitro model systems for gastrointestinal infection by choice of cell line, pH, microaerobic conditions, and optimization of culture conditions SK Linden, KM Driessen, MA McGuckin - Helicobacter, 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1523-5378.2007.00509.xH-FCIGRL-OH
Peptide H-FCIGRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FCIGRL-OH include the following: Larazotide acetate: A pharmacological peptide approach to tight junction regulation ZM Slifer, BR Krishnan, J Madan - American Journal of , 2021 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpgi.00386.2020 New strategies to improve the intranasal absorption of insulin X Duan , S Mao - Drug discovery today, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1359644610001091 The role of Haptoglobin and its related protein, Zonulin, in inflammatory bowel disease T Vanuytsel , S Vermeire, I Cleynen - Tissue barriers, 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/tisb.27321 The active Zot domain (aa 288-293) increases ZO-1 and myosin 1C serine/threonine phosphorylation, alters interaction between ZO-1 and its binding SE Goldblum, U Rai , A Tripathi, M Thakar - The FASEB , 2011 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3005425/ Novel non-injectable formulation approaches of peptides and proteins S Mao, D Cun, Y Kawashima - peptides, proteins, nucleic Acids , 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/pdf/10.1002/9780470688397#page=45 Peptides as skin penetration enhancers for low molecular weight drugs and macromolecules S Kumar, ST Narishetty, H Tummala - penetration enhancers chemical , 2015 - Springerhttps://link.springer.com/chapter/10.1007/978-3-662-47039-8_21 Preparation, drug distribution, and in vivo evaluation of the safety of protein corona liposomes for liraglutide delivery R Ding, Z Zhao, J He, Y Tao, H Zhang, R Yuan, K Sun - Nanomaterials, 2023 - mdpi.comhttps://www.mdpi.com/2079-4991/13/3/540 Technologies for Oral Delivery of Peptides N Mehta , W Stern - 2017 - books.rsc.orghttps://books.rsc.org/books/edited-volume/661/chapter/358500 Using peptides to increase transport across the intestinal barrier M Sanchez-Navarro , J Garcia , E Giralt - Advanced drug delivery , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0169409X16301417 Strategies that target tight junctions for enhanced drug delivery L Gonzalez-Mariscal, Y Posadas - Current , 2016 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cpd/2016/00000022/00000035/art00002 Application of Biomaterials in Percutaneous Absorption Enhancement L Fang, Y Chen - Methods in Penetration Enhancement: Modification of , 2015 - Springerhttps://link.springer.com/chapter/10.1007/978-3-662-47039-8_23 Paracellular permeation-enhancing effect of AT1002 C-terminal amidation in nasal delivery KH Song, SB Kim, CK Shim, SJ Chung - Drug Design , 2015 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.2147/DDDT.S79383 Effect of the six-mer synthetic peptide (AT1002) fragment of zonula occludens toxin on the intestinal absorption of cyclosporin A KH Song, A Fasano , ND Eddington - International journal of pharmaceutics, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378517307007636 Enhanced nasal absorption of hydrophilic markers after dosing with AT1002, a tight junction modulator KH Song, A Fasano , ND Eddington - European journal of pharmaceutics , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0939641107003591 ZOT-derived peptide and chitosan functionalized nanocarrier for oral delivery of protein drug JH Lee, A Sahu , WI Choi, JY Lee , G Tae - Biomaterials, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0142961216303192 of an innovative intradermal siRNA delivery system using a combination of a functional stearylated cytoplasm-responsive peptide and a tight junction-opening peptide H Ibaraki, T Kanazawa, Y Takashima, H Okada, Y Seta - Molecules, 2016 - mdpi.comhttps://www.mdpi.com/1420-3049/21/10/1279 Anti-RelA siRNA-encapsulated flexible liposome with tight junction-opening peptide as a non-invasive topical therapeutic for atopic dermatitis H Ibaraki, T Kanazawa, T Kurano, C Oogi - Biological and , 2019 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/bpb/42/7/42_b19-00259/_article/-char/ja/ Breaking down barriers: how understanding celiac disease pathogenesis informed the development of novel treatments F Valitutti, A Fasano - Digestive diseases and sciences, 2019 - Springerhttps://link.springer.com/article/10.1007/s10620-019-05646-y Recent progress in tight junction modulation for improving bioavailability D Saaber, S Wollenhaupt, K Baumann - Expert Opinion on Drug , 2014 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1517/17460441.2014.892070 Sequence-based Analysis of Zonula Occludens Toxins Identified by Comparative Genomics in Non-Toxigenic Vibrio Parahaemolyticus Strains Isolated in Southern D Perez-Reytor, D Castillo , CJ Blondel - 2019 - preprints.orghttps://www.preprints.org/manuscript/201905.0105 Analysis of the Zonula occludens Toxin Found in the Genome of the Chilean Non-toxigenic Vibrio parahaemolyticus Strain PMC53.7 D Perez-Reytor , A Pavon , C Lopez-Joven - Frontiers in cellular , 2020 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fcimb.2020.00482/full Modulation of tight junctions and efflux transporters at the blood-brain barrier to increase the delivery of chemotherapeutic and antiretroviral agents to the D Menon - 2005 - search.proquest.comhttps://search.proquest.com/openview/4c215fd3251ac3eaa5236c9aa61ce7fb/1?pq-origsite=gscholar&cbl=18750&diss=y Peptide permeation enhancers for improving oral bioavailability of macromolecules D Kim , L Jin, EJ Park, DH Na - Journal of Pharmaceutical Investigation, 2023 - Springerhttps://link.springer.com/article/10.1007/s40005-022-00609-4 Insulin Delivery to the Brain via the Nasal Route: Unraveling the Potential for Alzheimer's Disease Therapy CYJ Wong , A Baldelli , CM Hoyos , O Tietz - Drug Delivery and , 2024 - Springerhttps://link.springer.com/article/10.1007/s13346-024-01558-1 Trends in drug delivery through tissue barriers containing tight junctions C Tscheik, IE Blasig, L Winkler - Tissue barriers, 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/tisb.24565 Zonulin, a regulator of epithelial and endothelial barrier functions, and its involvement in chronic inflammatory diseases C Sturgeon, A Fasano - Tissue barriers, 2016 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/21688370.2016.1251384 Peptides as tight junction modulators A Takahashi, M Kondoh, M Kodaka - Current pharmaceutical , 2011 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cpd/2011/00000017/00000025/art00010 Zonulin and its regulation of intestinal barrier function: the biological door to inflammation, autoimmunity, and cancer A Fasano - Physiological reviews, 2011 - journals.physiology.orghttps://journals.physiology.org/doi/full/10.1152/physrev.00003.2008?view=long&pmid=21248165& Zonulin, regulation of tight junctions, and autoimmune diseases A Fasano - Annals of the New York Academy of Sciences, 2012 - Wiley Online Libraryhttps://nyaspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1749-6632.2012.06538.xH-YRKEQQSAVDADD-OH
Peptide H-YRKEQQSAVDADD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YRKEQQSAVDADD-OH include the following: Cross-reactive protection against influenza A virus by a topically applied DNA vaccine encoding M gene with adjuvant T Ozaki, M Yauchi, KQ Xin, F Hirahara, K Okuda - Viral immunology, 2005 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2005.18.373 Protection against influenza virus challenge by topical application of influenza DNA vaccine S Watabe, KQ Xin, A Ihata, LJ Liu, A Honsho, I Aoki - Vaccine, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X01001943 Protective immunity against influenza A virus induced by immunization with DNA plasmid containing influenza M gene K Okuda, A Ihata, S Watabe, E Okada, T Yamakawa - Vaccine, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X01000780Hippuric Acid
CAS:Formula:C9H9NO3Purity:>98.0%(T)Color and Shape:White powder to crystalMolecular weight:179.18TRPM8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRPM8 antibody, catalog no. 70R-5149Purity:Min. 95%H-NYLNYGEEGAPGK-OH
Peptide H-NYLNYGEEGAPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NYLNYGEEGAPGK-OH include the following: Quantitative proteomics suggests decrease in the secretogranin-1 cerebrospinal fluid levels during the disease course of multiple sclerosis AC Kroksveen, JD Jaffe, E Aasebo, H Barsnes - , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201400142MAGED2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGED2 antibody, catalog no. 70R-9922Purity:Min. 95%LCP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LCP1 antibody, catalog no. 70R-3076Purity:Min. 95%POFUT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POFUT2 antibody, catalog no. 70R-1592Purity:Min. 95%Enterotoxin STh
Peptide Enterotoxin STh is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Enterotoxin STh include the following: Glycoprotein receptors for a heat-stable enterotoxin (STh) produced by enterotoxigenic Escherichia coli T Hirayama, A Wada, N Iwata, S Takasaki - Infection and , 1992 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.60.10.4213-4220.1992 Prosequence switching: An effective strategy to produce biologically active E. coli heat-stable enterotoxin STh PR Weiglmeier, H Berkner, A Seebahn - Journal of , 2014 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2013.825758 Enterotoxigenic Escherichia coli heat-stable toxin increases the rate of zinc release from metallothionein and is a zinc-and iron-binding peptide MC Kiefer, NI Motyka, JD Clements, JP Bitoun - Msphere, 2020 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/msphere.00146-20 Full Capacity of Recombinant Escherichia coliHeat-Stable Enterotoxin Fusion Proteins for Extracellular Secretion, Antigenicity, Disulfide Bond Formation, and Activity I Batisson, M Der Vartanian - Infection and , 2000 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.68.7.4064-4074.2000 Extracellular DsbA-insensitive folding of Escherichia coli heat-stable enterotoxin STa in vitro I Batisson, M Der Vartanian - Journal of Biological Chemistry, 2000 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)89948-9/abstract Structural characterisation of the E. coli heat stable enterotoxin STh GI Matecko , BM Burmann , K Schweimer - The Open , 2008 - benthamopen.comhttps://benthamopen.com/ABSTRACT/TOSPECJ-2-34 Pathogenicity of enterotoxigenic Escherichia coli in Caenorhabditis elegans as an alternative model host A Matsuda, T Ishida, Y Tanimoto, T Wada - Bioscience , 2024 - academic.oup.comhttps://academic.oup.com/bbb/article-abstract/88/4/453/7504757Molecular weight:2,042.29 g/molSNRP70 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-1431Purity:Min. 95%HS1BP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HS1BP3 antibody, catalog no. 70R-4018Purity:Min. 95%TIGD3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TIGD3 antibody, catalog no. 70R-1209Purity:Min. 95%HsTX1
CAS:HsTX1, a 34-residue, C-terminally amidated peptide isolated from the scorpion Heterometrus spinnifer, features four disulfide bridges and acts as a potassiumFormula:C149H246N54O46S9Purity:98%Color and Shape:SolidMolecular weight:3818.47H-ALPNNTSSSPQPK-OH
Peptide H-ALPNNTSSSPQPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALPNNTSSSPQPK-OH include the following: Rapid assessment of RNAi-mediated protein depletion by selected reaction monitoring mass spectrometry VA Glukhova, DM Tomazela, GD Findlay - Journal of proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr400067k Comprehensive analysis of WRN protein interaction network by Mass Spectrometry. V Glukhova - 2014 - digital.lib.washington.eduhttps://digital.lib.washington.edu/researchworks/handle/1773/25376 p53 isoform profiling in glioblastoma and injured brain R Takahashi, C Giannini , JN Sarkaria, M Schroeder - Oncogene, 2013 - nature.comhttps://www.nature.com/articles/onc2012322 Variant peptide detection utilizing mass spectrometry: laying the foundations for proteogenomic identification and validation L Dimitrakopoulos, I Prassas , EMJJ Berns - Clinical Chemistry and , 2017 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/cclm-2016-0947/html Post-translational modification of p53 protein in response to ionizing radiation analyzed by mass spectrometry J Abraham, J Kelly, P Thibault , S Benchimol - Journal of molecular biology, 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283699934150H-IIADIFEYTAK^-OH
Peptide H-IIADIFEYTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IIADIFEYTAK^-OH include the following: Characterizing the mechanism of action for mRNA therapeutics for the treatment of propionic acidemia, methylmalonic acidemia, and phenylketonuria R Baek, K Coughlan, L Jiang, M Liang , L Ci - Nature , 2024 - nature.comhttps://www.nature.com/articles/s41467-024-47460-9 Long-term efficacy and safety of mRNA therapy in two murine models of methylmalonic acidemia D An, A Frassetto, E Jacquinet, M Eybye, J Milano - , 2019 - thelancet.comhttps://www.thelancet.com/article/S2352-3964(19)30438-4/abstractLeucokinin I acetate
Leucokinin I acetate is an antiserum raised against an insect myotropic peptide.Formula:C43H57N11O14Purity:98.02%Color and Shape:SolidMolecular weight:951.98Ref: TM-T20688L
1mg150.00€2mg207.00€5mg329.00€10mg472.00€25mg718.00€50mg932.00€100mg1,293.00€200mg1,738.00€CHAC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHAC1 antibody, catalog no. 70R-3936Purity:Min. 95%H-NFMESLPRLGMH-NH2
Peptide H-NFMESLPRLGMH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NFMESLPRLGMH-NH2 include the following: Screening of bio-recognition elements by phage display and their application in the detection of foodborne pathogens S Wu, L Sheng , X Lu, Y Ye, J Sun , J Ji, J Shao - TrAC Trends in , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S016599362300568X A high affinity phage-displayed peptide as a recognition probe for the detection of Salmonella Typhimurium S Agrawal, PK Kulabhusan , M Joshi , D Bodas - Journal of , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168165616302838CHCHD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHCHD1 antibody, catalog no. 70R-4035Purity:Min. 95%Heavy calcitonin peptide
Heavy calcitonin peptide - Stable Isotope PeptideHuman Calcitonin (hCT) is a 32-amino acid hormone peptide belonging to the Calcitonin/Calcitonin-gene related peptide (CGRP) family, that also comprises amylin, adrenomedullin (AM) and adrenomedullin2/intermedin (AM2/IMD). Calcitonin is characterized by a N-terminal disulfide bond that forms a 7 amino acid ring structure, a region with a α-helix tendency and an amidated C-terminus1.Calcitonin peptide is produced by C cells of the thyroid gland and binds preferentially to the G-protein coupled receptor, calcitonin receptor (CTR)1. Calcitonin receptor signals through activated Gs protein and the production of cAMP second messenger molecules by adenylyl cyclase1. The dissociation constant (Kd) of calcitonin receptors expressed by a human ovarian small cell carcinoma line is approximately 4.6 nM for human Calcitonin2.Calcitonin is involved in the homeostasis of calcium and phosphorus, and the regulation of bone dynamics. At the basal state, calcitonin secretion reduces plasma calcium and phosphorus levels, and promote bone formation. In Calca -/- mice, a murin particle-induced osteolysis model, Calcitonin peptide has been used as a test compound for studying the effects of calcitonin deficiency. It has been shown that artificial calcitonin subsitution inhibits bone resorption by reducing the formation of osteoclasts and thereby the resulting osteolytic reaction3. The Hypocalcemic Human calcitonin was also used as a positive control to monitor changes in serum calcium levels in HHD transgenic mice vaccinated with Parathyroid hormone-related protein (PTH-rP)-derived peptides in the context of anti-cancer immunotherapy study4. Moreover, it has been reported that calcitonin peptide is a potent stimulator of uncapacitated mouse spermatozoa by regulating a specific isoform of adenylyl cyclase and the production of cAMP, which plays a pivotal role in mammalian sperm function5.sb-PEPTIDE provides stable isotope labeled calcitonin peptide. This peptide has been quantified accurately using amino acid analysis.Hongotoxin-1
Hongotoxin-1, a chemical compound isolated from the venom of Centruroides limbatus, functions as a potassium channel inhibitor.Formula:C181H299N53O49S7Purity:98%Color and Shape:SolidMolecular weight:4226.13H-SPDIYNPQAGSLK^-OH
Peptide H-SPDIYNPQAGSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SPDIYNPQAGSLK^-OH include the following: Current challenges in detecting food allergens by shotgun and targeted proteomic approaches: a case study on traces of peanut allergens in baked cookies R Pedreschi , J Norgaard, A Maquet - Nutrients, 2012 - mdpi.comhttps://www.mdpi.com/2072-6643/4/2/132 Food allergen analysis: detection, quantification and validation by mass spectrometry M Planque, T Arnould , N Gillard - Allergen, 2017 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=TW2PDwAAQBAJ&oi=fnd&pg=PA7&dq=(%22H-SPDIYNPQAGSLK%5E-OH%22+OR+%22H-SPDIYNPQAGSLK-OH%22+OR+%22SPDIYNPQAGSLK%22+OR+%22NH2-Ser-Pro-Asp-Ile-Tyr-Asn-Pro-Gln-Ala-Gly-Ser-Leu-Lys%5E-OH%22+OR+%22SPDIYNPQAGSLK%5E%22)+AND+peptide&ots=hbHhB6i4S2&sig=udwGhMSSj-Jc5CBtMrcvJUIJh_g Food allergen analysis: detection, quantification and validation by mass spectrometry M Planque, T Arnould , N Gillard - Allergen, 2017 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=TW2PDwAAQBAJ&oi=fnd&pg=PA7&dq=(%22H-SPDIYNPQAGSLK%5E-OH%22+OR+%22H-SPDIYNPQAGSLK-OH%22+OR+%22SPDIYNPQAGSLK%22+OR+%22NH2-Ser-Pro-Asp-Ile-Tyr-Asn-Pro-Gln-Ala-Gly-Ser-Leu-Lys%5E-OH%22+OR+%22SPDIYNPQAGSLK%5E%22)+AND+peptide&ots=hbHhB6i4W3&sig=xjc0IcuPtjXgR87Di0mL2lbGItw Determination of peanut allergens in cereal-chocolate-based snacks: metal-tag inductively coupled plasma mass spectrometry immunoassay versus liquid M Careri, L Elviri , M Maffini, A Mangia - Journal Devoted to , 2008 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3427 Optimization of a sample preparation workflow based on UHPLC-MS/MS method for multi-allergen detection in chocolate: An outcome of the ThRAll project J Henrottin, R Pilolli, AC Huet, C van Poucke , C Nitride - Food Control, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0956713522004492 Proteomics-based approach to detect and identify major allergens in processed peanuts by capillary LC-Q-TOF (MS/MS) H Chassaigne, JV Norgaard - Journal of agricultural , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf063630e A Multimodal Understanding of Allergic Disease DM Croote - 2019 - search.proquest.comhttps://search.proquest.com/openview/31d842c40cc55719985edb9e0ce4b156/1?pq-origsite=gscholar&cbl=18750&diss=y Food allergen detection by mass spectrometry: The role of systems biology D Croote , SR Quake - NPJ systems biology and applications, 2016 - nature.comhttps://www.nature.com/articles/npjsba201622 Addressing complex matrix interference improves multiplex food allergen detection by targeted LC-MS/MS D Croote , I Braslavsky , SR Quake - Analytical chemistry, 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.9b01388 Global proteomic screening of protein allergens and advanced glycation endproducts in thermally processed peanuts CM Hebling, MA McFarland, JH Callahan - Journal of agricultural , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf303554t A targeted LC-MS/MS method for the simultaneous detection and quantitation of egg, milk, and peanut allergens in sugar cookies CC Boo, CH Parker, LS Jackson - Journal of AOAC International, 2018 - academic.oup.comhttps://academic.oup.com/jaoac/article-abstract/101/1/108/5653891 Particle-packed column versus silica-based monolithic column for liquid chromatography-electrospray-linear ion trap-tandem mass spectrometry multiallergen trace C Bignardi, L Elviri , A Penna, M Careri - of Chromatography A, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967310014007H-APVLFFDR^-OH
Peptide H-APVLFFDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-APVLFFDR^-OH include the following: Molecular-weight-dependent, anionic-substrate-preferential transport of beta-lactam antibiotics via multidrug resistance-associated protein 4 S Akanuma, Y Uchida, S Ohtsuki , J Kamiie - Drug metabolism and , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1347436715306431Arphamenine B
CAS:Arphamenine B is an enzyme inhibitor that inhibits metalloproteinases and serine proteases. It has been shown to be a potent osteoinductive agent in cell culture. Arphamenine B has also been found to have a depressant effect on the growth of cells in culture, with lysine residues as the probable site of action. Arphamenine B has also been shown to inhibit soybean trypsin, which is a serine protease enzyme.Formula:C16H24N4O4H2SO4•H2OPurity:Min. 95%Molecular weight:403.45 g/molGalanin (2-13)
Galanin is a widely distributed neuropeptide in the central nervous system, peripheral regions and endocrine system. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy.Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors which are inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway- receptor activation leads to a cellular influx of potassium ions.The galanin active fragment (1-16) has been identified as a highly potent agonist for the galanin receptors from binding assays. This has become a basis for galanin-based peptides, which are neuroactive. These are being investigated as a potential source for anticonvulsant neuropeptides as a therapeutic for conditions such as epilepsy. A library of galanin fragments has allowed screening of their properties to be assessed and used to generate chimeric peptides. Galanin fragments have different affinities for GalR receptors- however, the N-terminal (1-16) residues have been shown to have a conserved affinity for the receptors. This galanin (2-13) peptide is provided in the amide form. The acidic form is also available in our catalogue.Color and Shape:PowderMolecular weight:1,289.7 g/molADAM10 , human, recombinant
ADAM10 is a protease that regulates the cell-surface expression of other proteins. ADAM10 cleaves the extracellular domain of membrane-bound proteins and releases them into the extracellular space. This protein has been shown to be important in the progression of Alzheimer's disease by regulating the processing of amyloid precursor protein (APP). ADAM10 is also expressed at the cell surface, where it may function as an enzyme responsible for cleaving glycerol from lipids. The human form of this protein has a molecular mass of 27 kDa and an extracellular domain with a length of 217 amino acids, with n-terminal sequence that starts at position 1. ADAM10 is soluble and consists of two domains: an N-terminal domain and a C-terminal domain.Purity:Min. 95%Adiponectin (150-176) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:3,269 g/molPHC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PHC2 antibody, catalog no. 70R-9078Purity:Min. 95%SLC5A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A4 antibody, catalog no. 70R-1794Purity:Min. 95%H-DYVSQFEGSALGK^-OH
Peptide H-DYVSQFEGSALGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DYVSQFEGSALGK^-OH include the following: Unrestricted modification search reveals lysine methylation as major modification induced by tissue formalin fixation and paraffin embedding Y Zhang, M Muller , B Xu, Y Yoshida, O Horlacher - , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201400454 Stable Isotope-Labeled ApoA-1 as a Global Standard for Quantitative Proteomic Studies T Vaisar, AJ Percy , K Backiel, MN Oda - theanalyticalscientist.comhttps://theanalyticalscientist.com/fileadmin/tas/issues/App_Notes/05217-Cambridge-Isotopes-supplied.pdf Simultaneous quantification of apolipoprotein AI and apolipoprotein B by liquid-chromatography-multiple-reaction-monitoring mass spectrometry SA Agger, LC Marney , AN Hoofnagle - Clinical chemistry, 2010 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/56/12/1804/5622265 The application of ultra-performance liquid chromatography/tandem mass spectrometry to the detection and quantitation of apolipoproteins in human serum RG Kay , B Gregory, PB Grace - in Mass Spectrometry , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3130 Detection of metals and metalloproteins in the plasma of stroke patients by mass spectrometry methods P Kodali, KR Chitta , JA Landero Figueroa - Metallomics, 2012 - academic.oup.comhttps://academic.oup.com/metallomics/article-abstract/4/10/1077/6016034 Data-independent acquisition and parallel reaction monitoring mass spectrometry identification of serum biomarkers for ovarian cancer N Rauniyar , G Peng , TKT Lam , H Zhao - Biomarker , 2017 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1177/1177271917710948 Arginine-directed glycation and decreased HDL plasma concentration and functionality L Godfrey, N Yamada-Fowler, J Smith - Nutrition & , 2014 - nature.comhttps://www.nature.com/articles/nutd201431 A streamlined method for quantification of apolipoprotein A1 in human plasma by LC-MS/MS J Shi, YZ Zheng, DD Sin, ML DeMarco - Clinical Chemistry, 2018 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/64/12/1782/5608638 Evaluation of interspecimen trypsin digestion efficiency prior to multiple reaction monitoring-based absolute protein quantification with native protein calibrators I van den Broek, NPM Smit, FP Romijn - Journal of Proteome , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr400763d Quantifying protein measurands by peptide measurements: where do errors arise? I van den Broek, FP Romijn, NPM Smit - Journal of proteome , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr5011179 Comparative proteomic profiling of plasma very-low-density and low-density lipoproteins HY Sun, SF Chen, MD Lai , TT Chang, TL Chen - Clinica Chimica , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009898109006123 Simple method for quantitative analysis of N-linked glycoproteins in hepatocellular carcinoma specimens HJ Lee , K Na, EY Choi, KS Kim , H Kim - Journal of Proteome , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr900649b Parallel reaction monitoring (PRM) and selected reaction monitoring (SRM) exhibit comparable linearity, dynamic range and precision for targeted quantitative HDL GE Ronsein , N Pamir , PD von Haller, DS Kim - Journal of , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391914004990 Measurement of fractional synthetic rates of multiple protein analytes by triple quadrupole mass spectrometry AYH Lee, NA Yates, M Ichetovkin, E Deyanova - Clinical , 2012 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/58/3/619/5620621Z-His-Glu-Lys-AMC
CAS:Z-His-Glu-Lys-AMC is an activator of ion channels. It is a ligand that binds to the receptor and stimulates the opening of ion channels in cells. Z-His-Glu-Lys-AMC has been used as a research tool to study protein interactions, pharmacology, and cell biology. It has also been used to study ion channel function and its role in diseases such as epilepsy or schizophrenia.Formula:C35H41N7O9Purity:Min. 95%Molecular weight:703.74 g/molABCE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABCE1 antibody, catalog no. 70R-6268Purity:Min. 95%CKAP4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CKAP4 antibody, catalog no. 70R-6704Purity:Min. 95%H-ADQDNPWRAYLDLLFPTDTLLLDLLWCG-OH
Peptide H-ADQDNPWRAYLDLLFPTDTLLLDLLWCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ADQDNPWRAYLDLLFPTDTLLLDLLWCG-OH include the following: pHLIP targeted intracellular delivery of calicheamicin M DuPont, C Klumpp, M Iraca, D Allababidi - International Journal of , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0378517324001881 Targeted intracellular delivery of dimeric STINGa by two pHLIP peptides for treatment of solid tumors A Moshnikova, M DuPont, M Iraca, C Klumpp - Frontiers in , 2024 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fphar.2024.1346756/fullMolecular weight:3,314 g/molImperatoxin A TFA
Imperatoxin A TFA, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, acts as an activator of Ca2+-release channels/ryanodine receptors (RyRs). It facilitates the influx of Ca2+ from the sarcoplasmic reticulum into the cell.Formula:C148H254N58O45S6·xC2HF3O2Color and Shape:SolidMolecular weight:3758.35 (free base)BTK derived peptide
Catalogue peptide; min. 95% purityFormula:C72H115N17O18S2Molecular weight:1,570.95 g/molH-VLEAELLVLR^-OH
Peptide H-VLEAELLVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VLEAELLVLR^-OH include the following: A map of neurofilament light chain species in brain and cerebrospinal fluid and alterations in Alzheimer's disease MM Budelier, Y He , NR Barthelemy , H Jiang - Brain , 2022 - academic.oup.comhttps://academic.oup.com/braincomms/article-abstract/4/2/fcac045/6534379 Alterations in Lysosomal, Glial and Neurodegenerative Biomarkers in Patients with Sporadic and Genetic Forms of Frontotemporal Dementia J Hsiao-Nakamoto, CL Chiu, L VandeVrede , R Ravi - bioRxiv, 2024 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC10888909/ Stability dynamics of neurofilament and GFAP networks and protein fragments CL Phillips, M Faridounnia , D Armao - Current Opinion in Cell , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0955067423001151H-SRPTEKT-OH
Peptide H-SRPTEKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SRPTEKT-OH include the following: Characterising the molecular mode of action of connexin therapeutics for the treatment of retinal injury and disease YR Kim - 2016 - researchspace.auckland.ac.nzhttps://researchspace.auckland.ac.nz/handle/2292/30999 Characterizing the mode of action of extracellular Connexin43 channel blocking mimetic peptides in an in vitro ischemia injury model Y Kim, JM Griffin , PWR Harris , SHC Chan - et Biophysica Acta (BBA , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304416516304044 Synthesis and biological evaluation of S-lipidated lipopeptides of a connexin 43 channel inhibitory peptide SH Yang, CA Clemett , MA Brimble - RSC Medicinal , 2020 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2020/md/d0md00172d Synthesis and Biological Evaluation of Termini-Modified and Cyclic Variants of the Connexin43 Inhibitor Peptide5 SH Crystal Chan, JM Griffin , CA Clemett - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fchem.2022.877618/full The lipidated connexin mimetic peptide SRPTEKT-Hdc is a potent inhibitor of Cx43 channels with specificity for the pS368 phospho-isoform ML Cotter, S Boitano, PD Lampe - of Physiology-Cell , 2019 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpcell.00160.2019 Channels and Transporters in Cell Signaling: The lipidated connexin mimetic peptide SRPTEKT-Hdc is a potent inhibitor of Cx43 channels with specificity for ML Cotter, S Boitano, PD Lampe , JL Solan - American Journal of , 2019 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6850999/ Cell-to-Cell Communication and Signaling Pathways: Lipidated connexin mimetic peptides potently inhibit gap junction-mediated Ca2+-wave propagation ML Cotter, S Boitano, J Vagner - American Journal of , 2018 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6139506/ Lipidated connexin mimetic peptides potently inhibit gap junction-mediated Ca2+-wave propagation ML Cotter, S Boitano, J Vagner - American Journal of , 2018 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpcell.00156.2017 Development of Potent, Conformation-Specific Inhibitors of Connexin-Mediated Communication ML Cotter - 2018 - search.proquest.comhttps://search.proquest.com/openview/bd62517d1f1e7ec498c46935e566d97b/1?pq-origsite=gscholar&cbl=18750 The lipidated connexin mimetic peptide, SRPTEKT-Hdc, is a potent inhibitor of Cx43 channels 2 with specificity for the pS368 phospho-isoform 3 4 Maura L. Cotter1 JM Burt - journals.physiology.orghttps://journals.physiology.org/doi/prev/20190731-aop/epdf/10.1152/ajpcell.00160.2019 9 10 11 Maura L. Cotter, Scott Boitano, Josef Vagner 3, 4, and Janis M. Burt 12 13 JM Burt - journals.physiology.orghttps://journals.physiology.org/doi/prev/20180406-aop/epdf/10.1152/ajpcell.00156.2017 Prospects for rational development of pharmacological gap junction channel blockers DC Spray , R Rozental, M Srinivas - Current drug targets, 2002 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cdt/2002/00000003/00000006/art00006SNAI1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNAI1 antibody, catalog no. 70R-7981Purity:Min. 95%Histone H3 (10-29)-Biotin
Histone H3 (10-29)-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.Color and Shape:PowderMolecular weight:2,294.3 g/molGALK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALK1 antibody, catalog no. 70R-10394Purity:Min. 95%H-NPDDPDTVDVIMHMLDR^-OH
Peptide H-NPDDPDTVDVIMHMLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NPDDPDTVDVIMHMLDR^-OH include the following: Quantitation of peptides from non-invasive skin tapings using isotope dilution and tandem mass spectrometry N Reisdorph , M Armstrong, R Powell, K Quinn - of Chromatography B, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023217322158H-GTVNLTWSR-OH
Peptide H-GTVNLTWSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GTVNLTWSR-OH include the following: Glycoproteomic studies of IgE from a novel hyper IgE syndrome linked to PGM3 mutation G Wu, PG Hitchen, M Panico, SJ North - Glycoconjugate , 2016 - Springerhttps://link.springer.com/article/10.1007/s10719-015-9638-y(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-3-p henylpropanoyl]amino]acetyl]amino]-3-(4-hydroxyphenyl)propanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoyl]amino]-3-(4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H79N9O12Molecular weight:1,070.31 g/molH-LPLKMLNIPSINVH-OH
Peptide H-LPLKMLNIPSINVH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LPLKMLNIPSINVH-OH include the following: Actively personalized vaccination trial for newly diagnosed glioblastoma N Hilf, S Kuttruff-Coqui, K Frenzel, V Bukur - Nature, 2019 - nature.comhttps://www.nature.com/articles/s41586-018-0810-yDNAI2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAI2 antibody, catalog no. 70R-8543Purity:Min. 95%Sialokinin - 2
Catalogue peptide; min. 95% purityFormula:C51H76N12O16SMolecular weight:1,145.31 g/molH-TTPPVL^DSDGSF^FLYSR-OH
Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TTPPVL^DSDGSF^FLYSR-OH include the following: Absolute quantitation of immunoglobulin G and its glycoforms using multiple reaction monitoring Q Hong , CB Lebrilla , S Miyamoto - Analytical chemistry, 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac4009995 Method limitations in LC-MS/MS and immunonephelometric measurement of IgG subclasses G van der Gugten , A Mattman , G Ritchie - Clinical , 2021 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/67/2/440/6040699 Development of an LC-MS/MS method for absolute quantification of IgG4 by evaluating dependence on the digestion efficiency using a non-cleavable/dually D Sasaki, H Kashiwagura, Y Teruuchi - Biochemical and Biophysical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X23011737 Absolute and multiplex quantification of antibodies in serum using PSAQâ¢standards and LC-MS/MS D Lebert, G Picard, C Beau-Larvor, L Troncy - Bioanalysis, 2015 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.15.56ANP (Human, 5-27)
CAS:ANP (Human, 5-27) is a native peptide amino acid sequence that is found in the human body. It is also known as Atrial Natriuretic Peptide and is a ligand for the ANP receptor. ANP (Human, 5-27) has been shown to activate the receptor by binding with it and thus stimulate the production of cyclic guanosine monophosphate. This substance has been used as a research tool for pharmacology and cell biology studies because of its potential to inhibit or stimulate protein synthesis, depending on its concentration. It has also been used to produce antibodies against it.Formula:C97H154N34O32S3Purity:Min. 95%Molecular weight:2,404.7 g/molPCGF6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PCGF6 antibody, catalog no. 70R-2762Purity:Min. 95%H-HDVDALLW-OH
Peptide H-HDVDALLW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HDVDALLW-OH include the following: Graft-versus-leukemia antigen CML66 elicits coordinated B-cell and T-cell immunity after donor lymphocyte infusion W Zhang, J Choi, W Zeng, SA Rogers, EP Alyea - Clinical Cancer , 2010 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/16/10/2729/75177 Graft-Versus-Leukemia Antigen CML66 Elicits Coordinated B And T Cell Immunity After Donor Lymphocyte Infusion W Zhang, J Choi, W Zeng, EP Alyea - Biology of Blood and , 2010 - tctjournal.orghttps://www.tctjournal.org/article/S1083-8791(09)00657-0/abstract Graft-Versus-Leukemia Antigen CML66 Elicits Coordinated B and T Cell Immunity After Donor Lymphocyte Infusion. W Zhang, J Choi, W Zeng, EP Alyea III, C Canning - Blood, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006497119552600 Prospective Evaluation Of Proteomic Pattern Specific For aGvHD In More Than 300 Patients EM Weissinger, B Hertenstein, J Metzger - Biology of Blood and , 2010 - tctjournal.orghttps://www.tctjournal.org/article/S1083-8791(09)00655-7/abstract Proteomic Screening Applied To Early The Diagnosis Of Chronic Graft-Versus-Host-Disease EM Weissinger, A Klaus, J Metzger - Biology of Blood and , 2010 - tctjournal.orghttps://www.tctjournal.org/article/S1083-8791(09)00656-9/abstract In CML Patients, Residual Disease In Primitive Stem/Progenitor Cells Following Allogeneic Stem Cell Transplantation Is Higher Than After Treatment With Tyrosine ASM Yong, K Keyvanfar, R Eniafe - Biology of Blood and , 2010 - astctjournal.orghttps://www.astctjournal.org/article/S1083-8791(09)00658-2/abstractH-SYPSNATCPR-OH
Peptide H-SYPSNATCPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SYPSNATCPR-OH include the following: Endogenous Allergens from Genetically Modified Soybean: Background, Assessment, and Quantification T Geng, Y Wang, L Liu, B Li, RC Hill - Current Challenges and , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bk-2019-1300.ch006 Development, validation, and Interlaboratory evaluation of a quantitative multiplexing method to assess levels of ten endogenous allergens in soybean seed and its RC Hill, TJ Oman, X Wang, G Shan - Journal of agricultural , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jafc.7b01018Ezatiostat hydrochloride
CAS:Ezatiostat HCl (TLK199) inhibits glutathione S-transferase, GSTP1-1 specifically, and may treat cytopenias.Formula:C27H36ClN3O6SPurity:98%Color and Shape:SolidMolecular weight:566.11Ref: TM-T22776
2mg58.00€5mg82.00€10mg120.00€25mg200.00€50mg306.00€100mg517.00€200mg777.00€500mg1,165.00€1mL*10mM (DMSO)118.00€1-Aminocyclopropanecarboxylic Acid
CAS:Formula:C4H7NO2Purity:>97.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:101.11KCNK10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK10 antibody, catalog no. 70R-1532Purity:Min. 95%Peptide T
Peptide T is a macrophage-activating peptide that has been shown to be effective in treating AIDS-related immunodeficiency. It interacts with the specific target on human macrophages, causing them to proliferate and secrete cytokines. This peptide is effective in humans and has not been found to cause any adverse side effects. It also increases the number of blood lymphocytes in immunocompetent individuals, indicating its safety as a treatment for AIDS-related immunodeficiency.Formula:C35H55N9O16•4H2OPurity:Min. 95%Molecular weight:929.92 g/molH-LNENIR^-OH
Peptide H-LNENIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LNENIR^-OH include the following: Identification and quantitation of proteins using mass spectrometry-based peptide multiplex labelling methods B Williamson, S Nimkar - SpectroscopyEurope, 2008 - spectroscopyasia.comhttps://www.spectroscopyasia.com/system/files/pdf/MS_20_2.pdfH-GDSLAYGLR-OH
Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GDSLAYGLR-OH include the following: A novel cryptic binding motif, LRSKSRSFQVSDEQY, in the C-terminal fragment of MMP-3/7-cleaved osteopontin as a novel ligand for alpha9beta1 integrin is involved in the S Kon , Y Nakayama, N Matsumoto, K Ito, M Kanayama - PloS one, 2014 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0116210 Neutralizing antibody against osteopontin attenuates non-alcoholic steatohepatitis in mice M Honda, C Kimura, T Uede, S Kon - Journal of Cell Communication and , 2020 - Springerhttps://link.springer.com/article/10.1007/s12079-020-00554-7 Quantification of proteins using peptide immunoaffinity enrichment coupled with mass spectrometry L Zhao, JR Whiteaker , ME Pope, E Kuhn - JoVE (Journal of , 2011 - jove.comhttps://www.jove.com/t/2812/quantification-proteins-using-peptide-immunoaffinity-enrichment Overexpression of Fam20C in osteoblast in vivo leads to increased cortical bone formation and osteoclastic bone resorption K Hirose, T Ishimoto, Y Usami, S Sato, K Oya - Bone, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S8756328220301940 High-affinity recombinant antibody fragments (Fabs) can be applied in peptide enrichment immuno-MRM assays JR Whiteaker , L Zhao, C Frisch, F Ylera - Journal of Proteome , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr4009404 Integrated pipeline for mass spectrometry-based discovery and confirmation of biomarkers demonstrated in a mouse model of breast cancer JR Whiteaker , H Zhang, L Zhao, P Wang - Journal of proteome , 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr070202v Antigen-specific induction of osteopontin contributes to the chronification of allergic contact dermatitis AM Seier, AC Renkl, G Schulz, T Uebele - The American journal of , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0002944010603422 Neutralization of N-half Osteopontin Prevents Atherosclerotic Plaque Rupture in ApoE-/-Mice A Tanino - J Cardio Vasc Med, 2018 - jscholarpublishers.comhttp://www.jscholarpublishers.com/articles/JCVM/Neutralization-of-N-half.pdfAc-GYDPATGTFG-NH2
Peptide Ac-GYDPATGTFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-GYDPATGTFG-NH2 include the following: A study of ab initio folding of chignolins using replica-exchange molecular dynamics simulations G Cheng, P Wang, H Liu, D Zhang - Physical Chemistry Chemical , 2023 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2023/cp/d3cp03070aCyclo(Arg-Ala-Asp-D-Phe-Val)
CAS:Cyclo(Arg-Ala-Asp-D-Phe-Val) is an active, cyclic peptide that has been shown to have localized effects on the metaphase, meiosis, and gamete cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) is a cilengitide, which are small molecules that bind to calcium ions and increase intracellular levels of calcium. This leads to the activation of biochemical pathways in cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) has been shown to have a diacylglycerol antagonist effect in porcine oocytes and was used in clinical trials for the treatment of infertility. Cyclo(Arg-Ala-Asp-D-Phe Val) also has apoptotic activity in cancer cells.Formula:C27H40N8O7Purity:Min. 95%Molecular weight:588.68 g/molPSCD4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSCD4 antibody, catalog no. 70R-4408Purity:Min. 95%H-STQLLLR-OH
Peptide H-STQLLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-STQLLLR-OH include the following: Implementation and application of a versatile clustering tool for tandem mass spectrometry data K Flikka , J Meukens, K Helsens - , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200700160 Novel data analysis methods and algorithms for identification of peptides and proteins by use of tandem mass spectrometry H Xu - 2007 - rave.ohiolink.eduhttps://rave.ohiolink.edu/etdc/view?acc_num=osu1187113396H-GSLQPLALEGSLQKR-OH
Peptide H-GSLQPLALEGSLQKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GSLQPLALEGSLQKR-OH include the following: Characterization of proinsulin T cell epitopes restricted by type 1 diabetes-associated HLA class II molecules EL Ihantola, H Ilmonen, A Kailaanmaki - The Journal of , 2020 - journals.aai.orghttps://journals.aai.org/jimmunol/article/204/9/2349/107608RNF169 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF169 antibody, catalog no. 70R-2824Purity:Min. 95%O-(Benzotriazol-1-yl)-N,N,N',N'-bis(pentamethylene)uronium Hexafluorophosphate
CAS:Formula:C17H24F6N5OPPurity:>98.0%(HPLC)(qNMR)Color and Shape:White to Almost white powder to crystalMolecular weight:459.38N-(tert-Butoxycarbonyl)-D-phenylalanine
CAS:Formula:C14H19NO4Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:265.31GCS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GCS1 antibody, catalog no. 70R-6629Purity:Min. 95%M 1145 acetate
M1145 acetate: chimeric peptide, selective GAL2 agonist, Ki=6.55 nM; >90x affinity vs GAL1, 76x vs GalR3. Enhances galanin signal.Formula:C130H209N37O34Purity:99.1%Color and Shape:SolidMolecular weight:2834.28Glucagon (1-29)-[Cys(Cy5)]
Glucagon (1-29)-[Cys(Cy5)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains Cyanine 5 (Cy5), which is a widely used red fluorescent dye.Molecular weight:4,189 g/molH-LVAASQAALGL-OH
Peptide H-LVAASQAALGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LVAASQAALGL-OH include the following: Relative quantification of albumin and fibrinogen modifications by liquid chromatography tandem mass spectrometry in the diagnosis and monitoring of acute U Lankes, SO Brennan, TA Walmsley - of Chromatography B, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023215000987 A role for calpactin in calcium-dependent exocytosis in adrenal chromaffin cells SM Ali , MJ Geisow, RD Burgoyne - Nature, 1989 - nature.comhttps://www.nature.com/articles/340313a0 Ãâ12-Prostaglandin J2 as a Product and Ligand of Human Serum Albumin: Formation of an Unusual Covalent Adduct at His146 S Yamaguchi, G Aldini , S Ito , N Morishita - Journal of the , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja908878n A mass-spectroscopic method for measuring des-Leu albumin-A novel marker for chronic pancreatitis RD Ireland, SO Brennan, JA Gerrard , TA Walmsley - Clinical , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0009912012004973 Quantitative bottom-up proteomics depends on digestion conditions MS Lowenthal, Y Liang, KW Phinney - Analytical , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac4027274 Quantification of human serum albumin by combining chymotrypsin/trypsin digestion coupled with LC-MS/MS technique M Shi, X Duan, X Zheng, D Lu, Y Ge, N Zhang - Analytical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269723002816 Breach of autoreactive B cell tolerance by post-translationally modified proteins JS Dekkers, MK Verheul, JN Stoop, B Liu - Annals of the , 2017 - ard.bmj.comhttps://ard.bmj.com/content/76/8/1449.abstract Mass spectrometric characterization of covalent modification of human serum albumin by 4-hydroxy-trans-2-nonenal G Aldini , L Gamberoni, M Orioli - Journal of mass , 2006 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.1067 Some aspects of experimental design in targeted proteomics based on the use of selected reaction monitoring and isotope-labeled peptides ED Virus, AV Ivanov, BP Luzyanin - Journal of analytical , 2015 - Springerhttps://link.springer.com/article/10.1134/S1061934815130109 Forward transport of glycoproteins on leading lamellipodia in locomoting cells DF Kucik, EL Elson , MP Sheetz - Nature, 1989 - nature.comhttps://www.nature.com/articles/340315a0 HIGH RESOLUTION MASS SPECTROMETRIC STRATEGIES FOR DETECTION OF PROTEINS AND PEPTIDES COVALENTLY MODIFIED BY ELECTROPHILIC D Garzon - 2015 - air.unimi.ithttps://air.unimi.it/handle/2434/250677 Identification of endogenous site-specific covalent binding of catechol estrogens to serum proteins in human blood CM Fang, MC Ku, CK Chang, HC Liang - Toxicological , 2015 - academic.oup.comhttps://academic.oup.com/toxsci/article-abstract/148/2/433/2461517 An antibody-free LC-MS/MS method for the quantification of sex hormone binding globulin in human serum and plasma B Sleumer, J Zwerwer, M Van Faassen - Clinical Chemistry and , 2023 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/cclm-2022-1225/html Glycation sites of human plasma proteins are affected to different extents by hyperglycemic conditions in type 2 diabetes mellitus A Frolov , M Bluher, R Hoffmann - Analytical and bioanalytical chemistry, 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-8018-y Multiplexed LC-MS/MS assay for urine albumin A Beasley-Green, NM Burris, DM Bunk - Journal of Proteome , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr500204c Protein haptenation by amoxicillin: high resolution mass spectrometry analysis and identification of target proteins in serum A Ariza, D Garzon , DR Abanades, V de los RacaÂos - Journal of , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391912006744H-EPQAPWME-OH
Peptide H-EPQAPWME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EPQAPWME-OH include the following: The Peptide-Receptive Transition State of NBM Natarajan, TH Hansen, H David, MJR Boyd - 2012 - academia.eduhttps://www.academia.edu/download/43890997/The_Peptide-Receptive_Transition_State_o20160319-21209-1oas038.pdf The peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics MG Mage, MA Dolan, R Wang, LF Boyd - The Journal of , 2012 - journals.aai.orghttps://journals.aai.org/jimmunol/article/189/3/1391/83449QPCTL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of QPCTL antibody, catalog no. 70R-7419Purity:Min. 95%H-ASLEDLGWADWVLSPR-OH
Peptide H-ASLEDLGWADWVLSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ASLEDLGWADWVLSPR-OH include the following: Protection of beta cells against pro-inflammatory cytokine stress by the GDF15-ERBB2 signaling S Sarkar , F Syed , BJ Webb-Robertson , JT Melchior - medRxiv, 2023 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2023.11.27.23298904.abstractNSMCE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NSMCE1 antibody, catalog no. 70R-1645Purity:Min. 95%(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C42H74N10O12SMolecular weight:943.18 g/molH-SLFNTIAVL-OH
Peptide H-SLFNTIAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLFNTIAVL-OH include the following: Dipeptides promote folding and peptide binding of MHC class I molecules SK Saini , K Ostermeir - Proceedings of the , 2013 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1308672110 Antigen processing influences HIV-specific cytotoxic T lymphocyte immunodominance S Tenzer , E Wee, A Burgevin, G Stewart-Jones - Nature , 2009 - nature.comhttps://www.nature.com/articles/ni.1728 T cell receptor-targeted immunotherapeutics drive selective in vivo HIV-and CMV-specific T cell expansion in humanized mice M Li , SJ Garforth , KE O'Connor, H Su - The Journal of , 2021 - Am Soc Clin Investighttps://www.jci.org/articles/view/141051 Crosscurrents in HIV-1 evolution JN Blankson , JR Bailey , RF Siliciano - Nature Immunology, 2006 - nature.comhttps://www.nature.com/articles/ni0206-121 Gag sequences from HIV-1-infected individuals on highly active antiretroviral therapy differ from the consensus I Baars - 2017 - fse.studenttheses.ub.rug.nlhttps://fse.studenttheses.ub.rug.nl/15847/ Dual molecular mechanisms govern escape at immunodominant HLA A2-restricted HIV epitope DK Cole , A Fuller, G Dolton , E Zervoudi - Frontiers in , 2017 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2017.01503/full Conflicting selective forces affect T cell receptor contacts in an immunodominant human immunodeficiency virus epitope AKN Iversen, G Stewart-Jones, GH Learn - Nature , 2006 - nature.comhttps://www.nature.com/articles/ni1298MRPL49 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL49 antibody, catalog no. 70R-9977Purity:Min. 95%H-QITIPSQEQEHSQK^-OH
Peptide H-QITIPSQEQEHSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QITIPSQEQEHSQK^-OH include the following: Probing for the presence of semenogelin in human urine by immunological and chromatographic-mass spectrometric methods in the context of sports drug testing J Breuer, A Thomas , H Geyer - Analytical Science , 2022 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/ansa.202100058Colivelin TFA (867021-83-8 free base)
CAS:Colivelin (TFA) is a hybrid peptide composed of ADNF and AGA-(C8R)HNG17, a potent Humanin (HN) derivative.Formula:C121H207F3N32O37Purity:98%Color and Shape:SolidMolecular weight:2759.13G3-C12 TFA (848301-94-0 free base)
G3-C12 TFA Salt is a specific galectin-3 binding peptide with Ksubdsub of 88 nM and shows anticancer activity.Formula:C74H115N23O23S2·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:18733,5-Diaminobenzoic Acid Dihydrochloride
CAS:Formula:C7H8N2O2·2HClPurity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:225.07H-LSYTQQMEDLK-OH
Peptide H-LSYTQQMEDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSYTQQMEDLK-OH include the following: Identification of myocarditogenic peptides derived from cardiac myosin capable of inducing experimental allergic myocarditis in the Lewis rat. The utility of a class II KW Wegmann, W Zhao, AC Griffin - Journal of immunology , 1994 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/153/2/892/42185H-SLPVSVPVWGFK-OH
Peptide H-SLPVSVPVWGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLPVSVPVWGFK-OH include the following: Inducing autophagy: a comparative phosphoproteomic study of the cellular response to ammonia and rapamycin LM Harder, J Bunkenborg , JS Andersen - Autophagy, 2014 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/auto.26863DDX47 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX47 antibody, catalog no. 70R-1381Purity:Min. 95%Z-Leu-Leu-H aldehyde
Z-Leu-Leu-H aldehyde is a water soluble and non-toxic chemical compound that belongs to the class of heterocycles. It inhibits ion channels by binding to their receptor and also has a high affinity for ligand binding sites. Z-Leu-Leu-H aldehyde is used as a research tool in pharmacology, cell biology, and antibody production. It can be used to activate or inhibit the function of proteins in cells by acting as an agonist or antagonist, respectively. This chemical is also an inhibitor with high purity, which is suitable for use in protein crystallization experiments.Formula:C20H30N2O4Purity:Min. 95%Molecular weight:362.46 g/molSLC12A8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC12A8 antibody, catalog no. 70R-6803Dynorphin A (2-17), porcine
Catalogue peptide; min. 95% purityFormula:C90H146N30O21Molecular weight:1,984.36 g/molH-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolMAL-dPEG®4-Acid
CAS:MAL-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C18H28N2O9Purity:Min. 95%Molecular weight:315.39 g/molNUDT9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT9 antibody, catalog no. 70R-5104Purity:Min. 95%(Arg8) Vasopressin (AVP)
Arginine vasopressin (AVP) is a neurohypophysial hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. The major function of AVP is to regulate extracellular fluid volume and electrolyte homeostasis via its anti-diuretic action. It is also a vasoconstrictor and pressor agent. AVP is important to the central nervous system (CNS) and also has physiological actions in the peripheral organs, such as the kidney, heart and vascular beds.Color and Shape:PowderMolecular weight:1,083.4 g/mol3-Amino-3-(4-methoxyphenyl)propionic Acid
CAS:Formula:C10H13NO3Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:195.22ACMSD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACMSD antibody, catalog no. 70R-6311Purity:Min. 95%ACTH(1-39) trifluoroacetate
CAS:ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).Formula:C207H308N56O58SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:4,541.07 g/molPLOD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLOD2 antibody, catalog no. 70R-5438Purity:Min. 95%Fmoc-Lys(Boc)-Cys(Psi(Dmp,H)pro)-OH
CAS:Please enquire for more information about Fmoc-Lys(Boc)-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C38H45N3O9SPurity:Min. 95%Molecular weight:719.84 g/molH-FAHTVVTSR-OH
Peptide H-FAHTVVTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FAHTVVTSR-OH include the following: CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath YF Li, W He, A Mandal, YH Kim, L Digilio - Asian journal of , 2011 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3739192/PNRC2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNRC2 antibody, catalog no. 70R-3985Purity:Min. 95%Annexin A8-Like 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA8L2 antibody, catalog no. 70R-6044Purity:Min. 95%BTBD15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BTBD15 antibody, catalog no. 70R-8088Purity:Min. 95%Hainantoxin-IV
CAS:Hainantoxin-IV acts as a specific antagonist for tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with His28 and Lys32 being critical residues forFormula:C166H257N53O50S6Purity:98%Color and Shape:SolidMolecular weight:3987.53HXB2 gag NO-91/aa361 - 375
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,577.8 g/molH-YSQAVPAVTEGPIPEVLK^-OH
Peptide H-YSQAVPAVTEGPIPEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSQAVPAVTEGPIPEVLK^-OH include the following: Isotope-targeted glycoproteomics (IsoTaG) analysis of sialylated N- and O-glycopeptides on an Orbitrap Fusion Tribrid using azido and alkynyl sugars CM Woo, A Felix, L Zhang , JE Elias - Analytical and , 2017 - Springerhttps://link.springer.com/article/10.1007/s00216-016-9934-9G3BP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of G3BP1 antibody, catalog no. 70R-5892Purity:Min. 95%CONSENSUS B Tat - 15
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,681.8 g/molH-DSTYSLSSTLTLSK^-OH
Peptide H-DSTYSLSSTLTLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DSTYSLSSTLTLSK^-OH include the following: Identification of codon-specific serine to asparagine mistranslation in recombinant monoclonal antibodies by high-resolution mass spectrometry XC Yu, OV Borisov, M Alvarez, DA Michels - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac901541h Pharmacokinetics and Metabolism: Analysis of Low-abundant Deamidation and Oxidation Modifications in Therapeutic Species in Complex Biological Matrices by SC Mena Perez - 2021 - ediss.sub.uni-hamburg.dehttps://ediss.sub.uni-hamburg.de/handle/ediss/9495 Age-related isomerization of Asp in human immunoglobulin G kappa chain S Ha, T Kinouchi, N Fujii - Biochimica et Biophysica Acta (BBA)-Proteins , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570963920300558 Label-free peptide profiling of Orbitrapâ¢full mass spectra MK Titulaer, D de Costa, C Stingl, LJ Dekker - BMC research , 2011 - Springerhttps://link.springer.com/article/10.1186/1756-0500-4-21 Enhanced Pharmacokinetic Bioanalysis of Antibody-drug Conjugates using Hybrid Immunoaffinity Capture and Microflow LC-MS/MS M Suh , JB Powers, CM Daniels , Y Wu - The AAPS Journal, 2023 - Springerhttps://link.springer.com/article/10.1208/s12248-023-00835-0 Improving Quantification of Protein Therapeutics by Standardising the Sample Preparation Approach to LC-MS/MS Analysis: High-sensitivity Bioanalysis of EE Chambers, ME Lame - 2016 - researchgate.nethttps://www.researchgate.net/profile/Karen-Haas/publication/303483394_Improving_Quantification_of_Protein_Therapeutics_by_Standardising_the_Sample_Preparation_Approach_to_LC-MSMS_Analysis_High-sensitivity_Bioanalysis_of_Infliximab_and_Total_Antibody_Quantification_of_th/links/5744963c08ae9ace8421a432/Improving-Quantification-of-Protein-Therapeutics-by-Standardising-the-Sample-Preparation-Approach-to-LC-MS-MS-Analysis-High-sensitivity-Bioanalysis-of-Infliximab-and-Total-Antibody-Quantification-of.pdfHBV env (335 - 343)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H84N10O11Molecular weight:1,073.35 g/mol5-Aminoisophthalic Acid
CAS:Formula:C8H7NO4Purity:>98.0%(T)Color and Shape:White to Orange to Green powder to crystalMolecular weight:181.15H-TF^GSG^E-OH
Peptide H-TF^GSG^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TF^GSG^E-OH include the following: Mechanism and inhibition kinetics of peptide P13 as thrombin inhibitor F Chen, G Huang - International journal of biological macromolecules, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0141813019344551 Crystal structure of thrombin in complex with S-variegin: insights of a novel mechanism of inhibition and design of tunable thrombin inhibitors CY Koh , S Kumar , M Kazimirova , PA Nuttall - PloS one, 2011 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0026367GHRHR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GHRHR antibody, catalog no. 70R-7058Purity:Min. 95%Ac-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CA-NH2 include the following: Effect of calcium-binding peptide from Pacific cod (Gadus macrocephalus) bone on calcium bioavailability in rats Z Peng, H Hou , K Zhang, B Li - Food Chemistry, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0308814616317277 A Leu-Lys-rich antimicrobial peptide: activity and mechanism Y Park, DG Lee, SH Jang, ER Woo, HG Jeong - et Biophysica Acta (BBA , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570963902005411 Preparation of cucumber seed peptide-calcium chelate by liquid state fermentation and its characterization X Wang, A Gao, Y Chen, X Zhang, S Li, Y Chen - Food chemistry, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0308814617303333 Calcium-binding peptide derived from pepsinolytic hydrolysates of hoki (Johnius belengerii) frame WK Jung , SK Kim - European Food Research and Technology, 2007 - Springerhttps://link.springer.com/article/10.1007/s00217-006-0371-4 Fish-bone peptide increases calcium solubility and bioavailability in ovariectomised rats WK Jung , BJ Lee, SK Kim - British Journal of Nutrition, 2006 - cambridge.orghttps://www.cambridge.org/core/journals/british-journal-of-nutrition/article/fishbone-peptide-increases-calcium-solubility-and-bioavailability-in-ovariectomised-rats/82F42DDCFBD09A851DAEEEDF4BD0D7F4 A new Conus peptide ligand for Ca channel subtypes VD Monje, JA Haack , SR Naisbitt, G Miljanich - , 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/002839089390008Q Novel epoxysuccinyl peptides A selective inhibitor of cathepsin B, in vivo T Towatari, T Nikawa, M Murata, C Yokoo - FEBS , 1991 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1016/0014-5793(91)80319-X The role of citric acid in oral peptide and protein formulations: relationship between calcium chelation and proteolysis inhibition SH Welling, F Hubalek, J Jacobsen , DJ Brayden - European journal of , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0939641113003998 The plasma membrane of Leishmania donovani promastigotes is the main target for CA (1-8) M (1-18), a synthetic cecropin A-melittin hybrid peptide P DacaÂAZ-ACHIRICA, J UBACH, A GUINEA - Biochemical , 1998 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/330/1/453/36956 Calcium binding to amino acids and small glycine peptides in aqueous solution: Toward peptide design for better calcium bioavailability N Tang, LH Skibsted - Journal of agricultural and food chemistry, 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jafc.6b01534 An exploration of the calcium-binding mode of egg white peptide, Asp-His-Thr-Lys-Glu, and in vitro calcium absorption studies of peptide-calcium complex N Sun, Z Jin, D Li, H Yin, S Lin - Journal of agricultural and food , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jafc.7b03705 Novel peptide with a specific calcium-binding capacity from whey protein hydrolysate and the possible chelating mode L Zhao, Q Huang, S Huang, J Lin, S Wang - Journal of agricultural , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf502412f A peptide model for calmodulin trapping by calcium/calmodulin-dependent protein kinase II JA Putkey , MN Waxham - Journal of Biological Chemistry, 1996 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)79186-8/abstract A peptide inhibitor of HIV-1 assembly in vitro J Sticht, M Humbert , S Findlow , J Bodem - Nature structural & , 2005 - nature.comhttps://www.nature.com/articles/nsmb964 Preparation, characterization, and property evaluation of Hericium erinaceus peptide-calcium chelate H Gu, L Liang, Y Kang, R Yu, J Wang, D Fan - Frontiers in Nutrition, 2024 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fnut.2023.1337407/full Calcium-binding capacity of wheat germ protein hydrolysate and characterization of peptide-calcium complex FR Liu, L Wang, R Wang, ZX Chen - Journal of agricultural and , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jf401868z Quantum dot peptide biosensors for monitoring caspase 3 proteolysis and calcium ions DE Prasuhn, A Feltz, JB Blanco-Canosa , K Susumu - ACS , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/nn1016132 Control of calcite crystal morphology by a peptide designed to bind to a specific surface DB DeOliveira , RA Laursen - Journal of the American Chemical , 1997 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja972270w Two Chromogranin A-Derived Peptides Induce Calcium Entry in Human Neutrophils by Calmodulin-Regulated Calcium Independent Phospholipase A2 D Zhang, P Shooshtarizadeh, BJ Laventie , DA Colin - PLoS , 2009 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0004501 Protein kinase C phosphorylates the synthetic peptide Arg-Arg-Lys-Ala-Ser-Gly-Pro-Pro-Val in the presence of phospholipid plus either Ca2+ or a phorbol ester tumor CA O'Brian, DS Lawrence, ET Kaiser - and biophysical research , 1984 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0006291X84909513 N-terminal fatty acid substitution increases the leishmanicidal activity of CA (1-7) M (2-9), a cecropin-melittin hybrid peptide C Chicharro, C Granata , R Lozano - Antimicrobial agents , 2001 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/aac.45.9.2441-2449.2001 Mapping protein-peptide affinity: binding of peptidylsulfonamide inhibitors to human carbonic anhydrase II AM Cappalonga Bunn, RS Alexander - Journal of the , 1994 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/ja00091a006 Comparative activities of cecropin A, melittin, and cecropin A-melittin peptide CA (1-7) M (2-9) NH2 against multidrug-resistant nosocomial isolates of Acinetobacter A Giacometti , O Cirioni , W Kamysz, G D'Amato - Peptides, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978103002675Prolactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purityFormula:C103H156N32O25Molecular weight:2,242.59 g/molC14ORF148 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf148 antibody, catalog no. 70R-3453Purity:Min. 95%UFP 803 acetate
UFP 803 acetate is a potent ligand of urotensin-II (UT) receptor. UFP-803 displays the activity of a lower residual agonist.Formula:C52H68N10O14S2Purity:99.78%Color and Shape:SolidMolecular weight:1121.29H-VVQREKRAVGIGAMF-OH
Peptide H-VVQREKRAVGIGAMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VVQREKRAVGIGAMF-OH include the following: Engineering recombinant reoviruses to display gp41 membrane-proximal external-region epitopes from HIV-1 KW Boehme, M Ikizler, JA Iskarpatyoti, JD Wetzel - Msphere, 2016 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/mSphere.00086-16L-Glutamic acid, N-[(phenylmethoxy)carbonyl]-, 5-methyl ester
CAS:Formula:C14H17NO6Purity:98%Color and Shape:SolidMolecular weight:295.28788000000003N-Acetyl-S-benzyl-DL-cysteine
CAS:Formula:C12H15NO3SPurity:>98.0%(T)Color and Shape:White to Almost white powder to crystalineMolecular weight:253.32Hepatitus B Virus Pre-S Region (120-145)
Catalogue peptide; min. 95% purityFormula:C135H199N39O38SMolecular weight:3,008.32 g/molSuc-Leu-Leu-Val-Tyr-AMC
CAS:Suc-Leu-Leu-Val-Tyr-AMC is a peptide that is an activator of ion channels. It can be used to study the effects of ion channel activation on various cells and tissues. Suc-Leu-Leu-Val-Tyr-AMC has also been shown to inhibit ligand binding to some receptors, such as the acetylcholine receptor. This peptide can also be used as a research tool for pharmacology, protein interactions, and antibody production.Formula:C40H53N5O10Purity:Min. 95%Molecular weight:763.88 g/molMMP23B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MMP23B antibody, catalog no. 70R-6358Purity:Min. 95%H-YGIDWASGR-OH
Peptide H-YGIDWASGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIAPPER^-OH
Peptide H-IIAPPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IIAPPER^-OH include the following: Bioactive peptide discovery from edible insects for potential applications in human health and agriculture Y Quah , SR Tong, J Bojarska , K Giller , SA Tan - Molecules, 2023 - mdpi.comhttps://www.mdpi.com/1420-3049/28/3/1233 Identification of Host Proteins Packaged in H5N1 Avian Influenza Virus Particles Propagated in Embryonated Chicken Eggs by Mass Spectrometry W Zhi-Wu, SUN Wan-Chun, Z Yue, C Zhong-Yi - Chinese Journal of , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1872204011605379 Nutritional, molecular, and functional properties of a novel enzymatically hydrolyzed porcine plasma product M Solaca -Gines, L Miro , A Bellver-Sanchis - Plos one, 2024 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0301504 Bioactive peptides released from edible insects during gastrointestinal digestion JN del Hierro , B Hernandez-Ledesma - Digestion-Derived Peptides, 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780443191411000145 Purification, identification and hypolipidemic activities of three novel hypolipidemic peptides from tea protein H Ye, Y Xu, Y Sun, B Liu, B Chen, G Liu, Y Cao - Food Research , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0963996922015083 Alpha-Glucosidase Inhibitory Peptides: Sources, Preparations, Identifications, and Action Mechanisms H Lu, T Xie, Q Wu, Z Hu, Y Luo, F Luo - Nutrients, 2023 - mdpi.comhttps://www.mdpi.com/2072-6643/15/19/4267 CTGF/Hcs24 interacts with the cytoskeletal protein actin in chondrocytes G Yosimichi, S Kubota, T Hattori , T Nishida - Biochemical and , 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X02027390 Identification and characterization of edible cricket peptides on hypertensive and glycemic in vitro inhibition and their anti-inflammatory activity on RAW 264.7 F Hall, L Reddivari , AM Liceaga - Nutrients, 2020 - mdpi.comhttps://www.mdpi.com/2072-6643/12/11/3588 Evaluation of ACE, alpha-glucosidase, and lipase inhibitory activities of peptides obtained by in vitro digestion of selected species of edible insects E Zielià âska, M Karaà âº, B Baraniak - European Food Research , 2020 - Springerhttps://link.springer.com/article/10.1007/s00217-020-03495-y N,N-Dimethylaminopyrene as a fluorescent affinity mass tag for ligand-binding mode analysis A Arai, R Watanabe, A Hattori, K Iio, Y Hu, K Yoneda - Scientific Reports, 2020 - nature.comhttps://www.nature.com/articles/s41598-020-64321-9FAM120A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM120A antibody, catalog no. 70R-2701Purity:Min. 95%OTUB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OTUB2 antibody, catalog no. 70R-9723Hexa-D-arginine
CAS:Hexa-D-arginine is an inhibitor of furin,blocks the activation of Pseudomonas aeruginosa exotoxin A in vivo.Formula:C36H75N25O6Purity:100%Color and Shape:SolidMolecular weight:954.14SLC25A25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A25 antibody, catalog no. 70R-6787Purity:Min. 95%H-STGSWSTLK-OH
Peptide H-STGSWSTLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-STGSWSTLK-OH include the following: Inhibition of the Alternative Complement Pathway May Cause Secretion of Factor B, Enabling an Early Detection of Pancreatic Cancer MJ Lee, JY Cho, S Bae, HS Jung - Journal of Proteome , 2024 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.3c00695CTAP(TFA) (103429-32-9 free base)
CTAP(TFA) (103429-32-9 free base) is a potent, highly selective, and brain-penetrant antagonist of the μ-opioid receptor with IC50 of 3.5 nM.Formula:C53H70F3N13O13S2Purity:99.62%Color and Shape:SolidMolecular weight:1218.33α-Conotoxin SI
CAS:Sourced from the marine snail, conus striatus, this synthetic cone snail toxin is a nicotinic acetylcholine receptor blocker. This product has disulfide bonds between Cys2-Cys7 and Cys3-Cys7.Formula:C55H84N16O16S4Purity:Min. 95%Molecular weight:1,353.6 g/molH-AL^NSEALSV-OH
Peptide H-AL^NSEALSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AL^NSEALSV-OH include the following: Mutational Analysis of Gene Fusions Predicts Novel MHC Class I-Restricted T-Cell Epitopes and Immune Signatures in a Subset of Prostate Cancer JL Kalina, DS Neilson, YY Lin, PT Hamilton - Clinical Cancer , 2017 - AACRhttps://aacrjournals.org/clincancerres/article-abstract/23/24/7596/79980 Chimeric Amino Acid Rearrangements as Immune Targets in Prostate Cancer JJ Lum, F Hach, YY Lin, J Kalina, D Neilson, E Loy - 2016 - apps.dtic.milhttps://apps.dtic.mil/sti/citations/tr/ADA637027[D-Arg1,D-Pro2,D-Trp7,9,Leu11]-Substance P
Substance P is a peptide that is found in the central nervous system and peripheral tissues. It is an agonist at the neurokinin-1 receptor, which causes pain and inflammation. Substance P also has been shown to be a stimulant of gastrointestinal motility, and it may play a role in mood regulation. Some studies have shown that substance P may have an anti-inflammatory effect on the gut.Formula:C75H108N20O13•3HCI•8H2OPurity:Min. 95%Molecular weight:1,751.3 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C66H82N16O17SPurity:Min. 95%Molecular weight:1,403.52 g/mol[Asp5]-Oxytocin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H65N11O13S2Molecular weight:1,008.17 g/molH-AVQVHQDTLR^-OH
Peptide H-AVQVHQDTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVQVHQDTLR^-OH include the following: Alternative RISC assembly: binding and repression of microRNA-mRNA duplexes by human Ago proteins MM Janas, B Wang , AS Harris, M Aguiar, JM Shaffer - Rna, 2012 - rnajournal.cshlp.orghttps://rnajournal.cshlp.org/content/18/11/2041.shortUBE2J2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2J2 antibody, catalog no. 70R-1777Purity:Min. 95%Methyl N-(tert-Butoxycarbonyl)-3-[(3S)-2-oxo-3-pyrrolidinyl]-L-alaninate
CAS:Formula:C13H22N2O5Purity:>98.0%(T)(HPLC)Color and Shape:White to Light yellow powder to crystalMolecular weight:286.33Fluor-Y-OH
Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Fluor-Y-OH include the following: AD-Y Shaped Neuropeptide Y Mimetic Peptide-Dye Self-Assembly with Maximal Emission Beyond 1300 nm and Glioma Mitochondrial Activity Modulation Y Li, X He, P Wang, B Yuan , Y Pan, X Hu, L Lu, A Wu - Small, 2024 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/smll.202308621 BIIE0246, a potent and highly selective non-peptide neuropeptide YY2 receptor antagonist Y Dumont, A Cadieux, H Doods - British journal of , 2000 - Wiley Online Libraryhttps://bpspubs.onlinelibrary.wiley.com/doi/abs/10.1038/sj.bjp.0703162 Robust feeding following central administration of neuropeptide Y or peptide YY in chicks, Gallus domesticus WJ Kuenzel, LW Douglass, BA Davison - Peptides, 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0196978187900660 Altered cerebrospinal fluid neuropeptide Y and peptide YY immunoreactivity in anorexia and bulimia nervosa WH Kaye , W Berrettini, H Gwirtsman - Archives of general , 1990 - jamanetwork.comhttps://jamanetwork.com/journals/jamapsychiatry/article-abstract/495044 Neuropeptide Y and peptide YY neuronal and endocrine systems TL O'Donohue, BM Chronwall, RM Pruss, E Mezey - Peptides, 1985 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0196978185901809 Neuropeptide Y and peptide YY: major modulators of gastrointestinal blood flow and function SP Sheikh - American Journal of Physiology , 1991 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpgi.1991.261.5.g701 Evidence that arginyl-glycyl-aspartate peptides and fibrinogen gamma chain peptides share a common binding site on platelets. SC Lam, EF Plow, MA Smith, A Andrieux - Journal of Biological , 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925819757305 Proteolytic processing of neuropeptide Y and peptide YY by dipeptidyl peptidase IV R Mentlein, P Dahms, D Grandt, R Kruger - Regulatory peptides, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016701159390435B A nonamidated peptide homologous to porcine peptide YY and neuropeptide YY PC Andrews , D Hawke , JE Shively, JE DIXON - Endocrinology, 1985 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/116/6/2677/2539707 Neuropeptide Y and peptide YY inhibit lipolysis in human and dog fat cells through a pertussis toxin-sensitive G protein. P Valet, M Berlan, M Beauville - The Journal of , 1990 - Am Soc Clin Investighttps://www.jci.org/articles/view/114425 Novel peptide conjugates for tumor-specific chemotherapy M Langer, F Kratz, B Rothen-Rutishauser - Journal of medicinal , 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm001065f Interaction of peptide YY with rat intestinal epithelial plasma membranes: binding of the radioiodinated peptide M LABURTHE, B CHENUT - , 1986 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/118/5/1910/2540147 Stimulation of murine peritoneal macrophage functions by neuropeptide Y and peptide YY. Involvement of protein kinase C. M De la Fuente , I Bernaez, M Del Rio, A Hernanz - Immunology, 1993 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC1422192/ Leptin, neuropeptide Y, and peptide YY in long-term recovered eating disorder patients KA Gendall, WH Kaye , M Altemus , CW McConaha - Biological , 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006322398002923 Neuropeptide Y-a novel brain peptide with structural similarities to peptide YY and pancreatic polypeptide K Tatemoto, M Carlquist, V Mutt - Nature, 1982 - nature.comhttps://www.nature.com/articles/296659a0 Neuropeptide Y: complete amino acid sequence of the brain peptide. K Tatemoto - Proceedings of the National Academy of , 1982 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.79.18.5485 The first highly potent and selective non-peptide neuropeptide Y Y1 receptor antagonist: BIBP3226 K Rudolf, W Eberlein, W Engel, HA Wieland - European journal of , 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0014299994908222 Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY JA Bard, MW Walker, TA Branchek - Journal of Biological , 1995 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)88063-2/abstract Peptide YY: a neuroendocrine neighbor of note HM Cox - Peptides, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978106005225 Peptide synthesis in water and the use of immobilized carboxypeptidase Y for deprotection GP Royer, GM Anantharmaiah - Journal of the American Chemical , 1979 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/ja00506a051 Peptide YY (1-36) and peptide YY (3-36): Part I. Distribution, release and actions GH Ballantyne - Obesity surgery, 2006 - Springerhttps://link.springer.com/article/10.1381/096089206776944959 Neuropeptide Y and peptide YY as possible cerebrospinal fluid markers for major depression and schizophrenia, respectively E Widerlöv, LH Lindström, C Wahlestedt - Journal of psychiatric , 1988 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0022395688900301 Structural diversity of receptors for neuropeptide Y, peptide YY and pancreatic polypeptide D Larhammar - Regulatory peptides, 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167011596001103 Evolution of neuropeptide Y, peptide YY and pancreatic polypeptide D Larhammar - Regulatory peptides, 1996 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167011595001697 Novel generation of hormone receptor specificity by amino terminal processing of peptide YY D Grandt, S Teyssen, M Schimiczek - Biochemical and , 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X05815475 Characterization of two forms of peptide YY, PYY (1-36) and PYY (3-36), in the rabbit D Grandt, M Schimiczek, K Struk, J Shively - Peptides, 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0196978194900353 Peptide analogue studies of the hypothalamic neuropeptide Y receptor mediating pituitary adrenocorticotrophic hormone release CJ Small, DGA Morgan , K Meeran - Proceedings of the , 1997 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.94.21.11686 Neuropeptide Y and peptide YY: important regulators of energy metabolism AD Nguyen , H Herzog , A Sainsbury - Current Opinion in , 2011 - journals.lww.comhttps://journals.lww.com/co-endocrinology/fulltext/2011/02000/Neuropeptide_Y_and_peptide_YY__important.12.aspx Characterization of peptide YY receptors in the brain A INUI, M OKITA, T INOUE, N SAKATANI, M OYA - , 1989 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/124/1/402/2531835H-IIDGVPVEITEK^-OH
Peptide H-IIDGVPVEITEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IIDGVPVEITEK^-OH include the following: Proteomic profiling of TGFBI-null mouse corneas reveals only minor changes in matrix composition supportive of TGFBI knockdown as therapy against TGFBI ET Poulsen , K Runager, NS Nielsen - The FEBS , 2018 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.14321nef protein (75-82) [Human immunodeficiency virus 1]
Nef is an accessory protein highly conserved amongst all primate lentiviruses, it is essential for viral replication in vivo- it is expressed by human immunodeficiency virus (HIV) HIV-1 and HIV-2. Nef acts as a downregulator of class I human leukocyte antigens (HLA) expression in HIV-infected cells to help circumvent the immune response, such as cytotoxic T lymphocytes (CTL) activity. An intact nef gene is critical for high viral loads, linked to development of acquired immunodeficiency syndrome (AIDS). Certain alleles of HLA have been associated with maintaining a seronegative status such as HLA-A*1101. This nef peptide sequence (75-82) was crystallised within the class I B allele HLA B*3501 suggesting an importance of key residues required for HLA interaction resulting in a nonstandard conformational binding.Molecular weight:975.5 g/molH-GNLEWK-OH
Peptide H-GNLEWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GNLEWK-OH include the following: Human FcRn tissue expression profile and half-life in PBMCs YY Fan, V Farrokhi , T Caiazzo, M Wang, DM O'Hara - Biomolecules, 2019 - mdpi.comhttps://www.mdpi.com/2218-273X/9/8/373H-KVLEYVIK^V-OH
Peptide H-KVLEYVIK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KVLEYVIK^V-OH include the following: Identification of Two Novel HLA-AâËâ0201-Restricted CTL Epitopes Derived from MAGE-A4 ZC Jia, B Ni, ZM Huang, Y Tian, J Tang - Journal of , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/full/10.1155/2010/567594 Evaluation of antitumor immunity efficacy of epitope-based vaccine with B16 cell line coexpressing HLA-A2/H-2kb and CTL multiepitope in HLA transgenic mice S Song, F Wang, X He, Y He, D Li, S Sun - Vaccine, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X06013600 A MAGE-A1 HLA-A* 0201 epitope identified by mass spectrometry S Pascolo, M Schirle , B GuÃËckel, T Dumrese, S Stumm - Cancer Research, 2001 - AACRhttps://aacrjournals.org/cancerres/article-abstract/61/10/4072/507436 A MAGE-1 antigenic peptide recognized by human cytolytic T lymphocytes on HLA-A2 tumor cells S Ottaviani, Y Zhang , T Boon - Cancer Immunology , 2005 - Springerhttps://link.springer.com/article/10.1007/s00262-005-0705-2 PeptiCHIP: a microfluidic platform for tumor antigen landscape identification S Feola, M Haapala , K Peltonen, C Capasso - ACS , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsnano.1c04371 PeptiCHIP: a novel microfluidic-based chip platform for tumour antigen landscape identification S Feola, M Haapala , K Peltonen, C Capasso, B Martins - 2021 - researchsquare.comhttps://www.researchsquare.com/article/rs-156531/latest Molecular mimicry and cancer vaccine development M Tagliamonte , B Cavalluzzo, A Mauriello, C Ragone - Molecular Cancer, 2023 - Springerhttps://link.springer.com/article/10.1186/s12943-023-01776-0 An innovative approach for HLA typing, molecular tumor testing and the validation of tumor exclusive antigens M Ghosh, L Bichmann, J Scheid, G Guler, H Schuster - bioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.06.05.136754.abstract 225 Optimal-affinity MAGE-A1-specific T cell receptors (TCRs) generated using the humanized TCR-transgenic mouse platform HuTCR are superior to human donor I Gavvovidis, M Leisegang - Journal for , 2021 - search.proquest.comhttps://search.proquest.com/openview/9fa995bc99604cab6fe8e913be377d2f/1?pq-origsite=gscholar&cbl=2040222 Generation of a HuTCR mouse platform-derived MAGE-A1-directed high-affinity TCR with superior potency versus human-derived TCRs. I Gavvovidis, M Leisegang, J Oduro, M Obenaus, E Leo - 2021 - ascopubs.orghttps://ascopubs.org/doi/abs/10.1200/JCO.2021.39.15_suppl.e14515 Avidity optimization of a MAGE-A1-specific TCR with somatic hypermutation D Bassan, YM Gozlan, A Sharbi-Yunger - European journal of , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.202049007 Molecular mimicry of SARS-COV-2 antigens as a possible natural anti-cancer preventive immunization C Ragone, A Mauriello, B Cavalluzzo - Frontiers in , 2024 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2024.1398002/abstractH-IL^DTAGLEEY-OH
Peptide H-IL^DTAGLEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IL^DTAGLEEY-OH include the following: Self-peptides bound to the type I diabetes associated class II MHC molecules HLA-DQ1 and HLA-DQ8 RM Chicz, WS Lane , RA Robinson - International , 1994 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/6/11/1639/757368GTPBP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP1 antibody, catalog no. 70R-9088Purity:Min. 95%H-ILSPFLPL-OH
Peptide H-ILSPFLPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ILSPFLPL-OH include the following: Human serum amyloid P functions as a negative regulator of the innate and adaptive immune responses to DNA vaccines Y Wang, Y Guo, X Wang, J Huang - The Journal of , 2011 - journals.aai.orghttps://journals.aai.org/jimmunol/article/186/5/2860/762 The adjuvant effects of co-stimulatory molecules on cellular and memory responses to HBsAg DNA vaccination X Du, G Zheng, H Jin, Y Kang , J Wang - The Journal of Gene , 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jgm.1004 Hemokinin-1 as an adjuvant molecule enhancing humoral and memory responses to HBsAg DNA vaccination X Chen, W Zhang, W Gao, Q Zou , C Feng, H Liu - Viral , 2012 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2012.0015 Levamisole is a potential facilitator for the activation of Th1 responses of the subunit HBV vaccination W Zhang, X Du, G Zhao, H Jin, Y Kang , C Xiao, M Liu - Vaccine, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X09008603 Endoplasmic reticulum targeting sequence enhances HBV-specific cytotoxic T lymphocytes induced by a CTL epitope-based DNA vaccine W Xu, Y Chu , R Zhang, H Xu, Y Wang, S Xiong - Virology, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682205000899 Induction of CTL responses and identification of a novel epitope of hepatitis B virus surface antigens in C57BL/6 mice immunized with recombinant vaccinia viruses S Roh, YK Lee, BY Ahn, K Kim, A Moon - Virus Research, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168170200002197 Different immunogenicity of H-2 Kb-restricted epitopes in natural variants of the hepatitis B surface antigen R Schirmbeck, W Böhm, N Fissolo - European journal of , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200324125 Breaking tolerance in hepatitis B surface antigen (HBsAg) transgenic mice by vaccination with cross-reactive, natural HBsAg variants R Schirmbeck, N Dikopoulos, M Kwissa - European journal of , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200324403 Adjuvants that enhance priming of cytotoxic T cells to a Kb-restricted epitope processed from exogenous but not endogenous hepatitis B surface antigen R Schirmbeck, K Melber, J Reimann - International immunology, 1999 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/11/7/1093/667756 Similar as well as distinct MHC class I-binding peptides are generated by exogenous and endogenous processing of hepatitis B virus surface antigen R Schirmbeck, J Wild, J Reimann - European journal of , 1998 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1521-4141(199812)28:12%3C4149::AID-IMMU4149%3E3.0.CO;2-D The immunodominant, Ld-restricted T cell response to hepatitis B surface antigen (HBsAg) efficiently suppresses T cell priming to multiple Dd-, Kd-, and Kb-restricted R Schirmbeck, D Stober, S El Kholy, P Riedl - The Journal of , 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/168/12/6253/33599 Mafosfamide combine with GMI-HBVac against HBV via Treg depletion in HBV-infected mice Q Lin, Y Zhong, B Wang - 2023 - preprints.orghttps://www.preprints.org/manuscript/202303.0085 A novel therapeutic hepatitis B vaccine induces cellular and humoral immune responses and breaks tolerance in hepatitis B virus (HBV) transgenic mice P Buchmann, C Dembek, L Kuklick, C Jager - Vaccine, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X12018610 Hyper-IL-15 suppresses metastatic and autochthonous liver cancer by promoting tumour-specific CD8+ T cell responses L Cheng, X Du , Z Wang, J Ju, M Jia , Q Huang - Journal of , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168827814004723 Alternative pathways for processing exogenous and endogenous antigens that can generate peptides for MHC class I-restricted presentation J Reimann, R Schirmbeck - Immunological reviews, 1999 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1600-065X.1999.tb01362.x Adjuvant effect of CIA07, a combination of Escherichia coli DNA fragments and modified lipopolysaccharides, on the immune response to hepatitis B virus surface ES Song, SA Park, SH Kim, YJ Cho - FEMS Immunology & , 2007 - academic.oup.comhttps://academic.oup.com/femspd/article-abstract/51/3/496/631551 Dendritic cells pulsed with exogenous hepatitis B surface antigen particles efficiently present epitopes to MHC class I-restricted cytotoxic T cells D Stober<, Z Trobonjaca , J Reimann - European journal of , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1521-4141(200204)32:4%3C1099::AID-IMMU1099%3E3.0.CO;2-8 NKT cells provide help for dendritic cell-dependent priming of MHC class I-restricted CD8+ T cells in vivo D Stober, I JomantaiteÃâ¡, R Schirmbeck - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/170/5/2540/71290 Synthetic innate defense regulator peptide combination using CpG ODN as a novel adjuvant induces long"âlasting and balanced immune responses CH Yu, ZC Luo , M Li, L Lu, Z Li - Molecular , 2016 - spandidos-publications.comhttps://www.spandidos-publications.com/10.3892/mmr.2015.4581?text=abstract B7-H1 on hepatocytes facilitates priming of specific CD8 T cells but limits the specific recall of primed responses C Wahl, P Bochtler, L Chen , R Schirmbeck, J Reimann - Gastroenterology, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0016508508009517 Modified alphavirus-vesiculovirus hybrid vaccine vectors for homologous prime-boost immunotherapy of chronic hepatitis B C Chiale , TO Yarovinsky, SW Mason, BR Madina - Vaccines, 2020 - mdpi.comhttps://www.mdpi.com/2076-393X/8/2/279 In Vivo Compartmentalization of Functionally Distinct, Rapidly Responsive Antigen-Specific T-Cell Populations in DNA-Immunized or Salmonella enterica Serovar AC Kirby, M Sundquist, MJ Wick - Infection and immunity, 2004 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.72.11.6390-6400.2004 Low-dose adenovirus vaccine encoding chimeric hepatitis B virus surface antigen-human papillomavirus type 16 E7 proteins induces enhanced E7-specific antibody A Baez-Astacaºa, E Herraez-Hernandez, N Garbi - Journal of , 2005 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.79.20.12807-12817.2005Nesiritide
CAS:Nesiritide, recombinant human B-type natriuretic peptide, binds NPR-A/C with Kd 7.3/13 pM.Formula:C143H244N50O42S4Purity:98%Color and Shape:SolidMolecular weight:3464.04Aquaporin-2 (255-271), rat
Catalogue peptide; min. 95% purityFormula:C78H131N25O26Molecular weight:1,835.07 g/molCCK-Tetrapeptide (30-33)
CAS:CCK-Tetrapeptide (30-33) is a peptide hormone that is structurally related to cholecystokinin. It has been shown to inhibit the activity of adenylate cyclase and phosphodiesterase, which are enzymes that are involved in cellular signaling. CCK-Tetrapeptide (30-33) has significant interactions with other drugs and can cause symptoms such as nausea, vomiting, diarrhea, or headache.Formula:C29H36N6O6S•HCI•H2OPurity:Min. 95%Molecular weight:651.18 g/molH-KAVGNFATM-OH
Peptide H-KAVGNFATM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KAVGNFATM-OH include the following: Positive selection of low responsive, potentially autoreactive T cells induced by high avidity, non-deleting interactions. AP Chidgey , RL Boyd - International immunology, 1998 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/10/7/999/760043Amyloid β-Protein (Human, 1-38)
CAS:Amyloid β-Protein (Human, 1-38) is a peptide that is a major constituent of the amyloid plaques found in the brains of people with Alzheimer's disease. It has been shown to inhibit ion channels and ligand-activated ion channels. The receptor for this protein is unknown, but it may be involved in cell signaling or neurotransmitter release. Amyloid β-Protein (Human, 1-38) can be used as a research tool to study proteins and their interactions with other proteins, as well as to study how these interactions affect the function of cells. It can also be used to study how antibody molecules bind to specific proteins and how these antibodies interact with other molecules.Formula:C184H277N51O56SPurity:Min. 95%Molecular weight:4,131.5 g/molH-ELL^ETGDNR^-OH
Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ELL^ETGDNR^-OH include the following: Proenkephalin decreases in cerebrospinal fluid with symptom progression of Huntington's disease V Niemela , AM Landtblom, D Nyholm - Movement , 2021 - Wiley Online Libraryhttps://movementdisorders.onlinelibrary.wiley.com/doi/abs/10.1002/mds.28391H-KVLEHVVRV-OH
Peptide H-KVLEHVVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KVLEHVVRV-OH include the following: Identification of Two Novel HLA-AâËâ0201-Restricted CTL Epitopes Derived from MAGE-A4 ZC Jia, B Ni, ZM Huang, Y Tian, J Tang - Journal of , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/full/10.1155/2010/567594TentaGel® S SH Resin (90 um)
TentaGel is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. The TentaGel S base resins are available with several different derivative choices. The typical capacity range for our TentaGel base resins is 0.2-0.3 meq/g. Application: (90 µm) Substitution Functional Group:-CH2-CH2-SHPurity:Min. 95%H-SYGQPQSGSYSQQPS-OH
Peptide H-SYGQPQSGSYSQQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SYGQPQSGSYSQQPS-OH include the following: Activity-dependent FUS dysregulation disrupts synaptic homeostasis CF Sephton , AA Tang, A Kulkarni - Proceedings of the ..., 2014 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1406162111H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 include the following: Lipid nanoparticles produce chimeric antigen receptor T cells with interleukin-6 knockdown in vivo J Zhou, L Sun , Y Jia, Z Wang, T Luo, J Tan - Journal of Controlled , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365922005387Slc25a27 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Slc25a27 antibody, catalog no. 70R-8578Purity:Min. 95%IDR 1002
Synthetic host defence peptide derivative with strong anti-inflammatory properties.Molecular weight:1,651 g/mol[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purityFormula:C67H112N16O25Molecular weight:1,541.73 g/molDNAJB9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB9 antibody, catalog no. 70R-7401Purity:Min. 95%H-KHNLGHGHKHERDQGHGHQR-NTBiot
Peptide H-KHNLGHGHKHERDQGHGHQR-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KHNLGHGHKHERDQGHGHQR-NTBiot include the following: Alterations of the plasma peptidome profiling in colorectal cancer progression C Bedin, S Crotti, E Ragazzi - Journal of Cellular , 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jcp.25196H-pFR-OH
Peptide H-pFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-pFR-OH include the following: Preparation and Properties of Chromopeptides from the Pfr Form of Phytochrome Z Naturforsch - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/znc-1981-5-616/pdf?licenseType=open-access The antimicrobial peptide PFR induces necroptosis mediated by ER stress and elevated cytoplasmic calcium and mitochondrial ROS levels: cooperation with Ara-C to Y Lv, G Shao, Q Zhang, X Wang, Y Meng - Signal transduction and , 2019 - nature.comhttps://www.nature.com/articles/s41392-019-0073-6 PFR peptide, one of the antimicrobial peptides identified from the derivatives of lactoferrin, induces necrosis in leukemia cells Y Lu, TF Zhang, Y Shi, HW Zhou, Q Chen, BY Wei - Scientific reports, 2016 - nature.comhttps://www.nature.com/articles/srep20823 Chromophore structure of the physiologically active form (Pfr) of phytochrome W Rudiger, F Thummler, E Cmiel - Proceedings of the , 1983 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.80.20.6244 T cell receptor recognition of MHC class II-bound peptide flanking residues enhances immunogenicity and results in altered TCR V region usage RT Carson, KM Vignali , DL Woodland, DAA Vignali - Immunity, 1997 - cell.comhttps://www.cell.com/immunity/pdf/S1074-7613(00)80360-X.pdf Cutting Edge: Immunoregulation of Th Cells by Naturally Processed Peptide Antagonists RT Carson, DD Desai, KM Vignali - The Journal of , 1999 - journals.aai.orghttps://journals.aai.org/jimmunol/article/162/1/1/31590 In vitro and in vivo studies of dansylated compounds, the putative agonists and antagonists on neuropeptide FF receptors Q Fang, J Guo, Y Peng, M Chang, F He , Q Chen - Peptides, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978105005243 The majority of immunogenic epitopes generate CD4+ T cells that are dependent on MHC class II-bound peptide-flanking residues PY Arnold, NL La Gruta , T Miller, KM Vignali - The Journal of , 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/169/2/739/71035 Expression, purification and structural studies of a short antimicrobial peptide M Zorko, B Japelj, I Hafner-Bratkovià- Biochimica et Biophysica , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0005273608003404 Analgesic properties of chimeric peptide based on morphiceptin and PFRTic-amide M Li, L Zhou, G Ma, S Dong - Regulatory Peptides, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0167011512002248 The cardiovascular effects of a chimeric opioid peptide based on morphiceptin and PFRTic-NH2 M Li, L Zhou, G Ma, S Cao, S Dong - Peptides, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978112004512 Functional properties of Pfr (Tic) amide and BIBP3226 at human neuropeptide FF2 receptors M Engström, S Wurster, JM Savola, P Panula - Peptides, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978103003310 Continuous peptide synthesis in a water-immiscible organic solvent with an immobilized enzyme K Nakanishi, R Matsuno - Annals of the New York Academy of , 1990 - Wiley Online Libraryhttps://nyaspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1749-6632.1990.tb18239.x Rat NPFF1 receptor-mediated signaling: functional comparison of neuropeptide FF (NPFF), FMRFamide and PFR (Tic) amide JC Chen, WH Lee, PC Chen, CP Tseng, EYK Huang - Peptides, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0196978106000441 Conserved binding regions provide the clue for peptide-based vaccine development: a chemical perspective H Curtidor , C Reyes , A Bermacaºdez , M Vanegas - Molecules, 2017 - mdpi.comhttps://www.mdpi.com/1420-3049/22/12/2199 Chromopeptides from Phytochrome and Phycocyanin. NM R Studies of the Pfr and Pr Chromophore of Phytochrome and E,Z Isomeric Chromophores of F Thummler, W Rudiger, E Cmiel - fur Naturforschung C, 1983 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/znc-1983-5-605/html Preparation and Properties of Chromopeptides from the Pfr Form of Phytochrome F Thummler, T Brandlmeier, W Rudiger - fur Naturforschung C, 1981 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/znc-1981-5-616/html Pharmacological Activities and Hydrolysis by Peptidases of [Phospho-Ser6]-Bradykinin (pS6-BK) DM Assis , L Juliano , T Paschoalin - Biochemical , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006295215004220 Characterization of bacterial proteases with a panel of fluorescent peptide substrates D Wildeboer, F Jeganathan, RG Price - Analytical , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269708006830 Re-Directing CD4+ T Cell Responses with the Flanking Residues of MHC Class II-Bound Peptides: The Core is Not Enough CJ Holland, DK Cole , A Godkin - Frontiers in immunology, 2013 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2013.00172/full Investigation of the Non-Covalent Interactions between Fragment Peptides of Bradykinin by Mass Spectrometry C Chen, YQ CHU, XH DAI, X FANG - Acta Physico-Chimica , 2013 - ingentaconnect.comhttps://www.ingentaconnect.com/content/apcs/apcs/2013/00000029/00000006/art00028 Practical Considerations and Examples in Adapting Amidations to Continuous Flow Processing in Early Development B Li, GA Weisenburger - Process Research & , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.oprd.0c00112 processed HLA class II peptides reveal highly conserved immunogenic flanking region sequence preferences that reflect antigen processing rather than peptide-MHC AJ Godkin, KJ Smith, A Willis - The Journal of , 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/166/11/6720/43679 Catalytic IgG from Patients with Hemophilia AITF VIII - J Immunol, 2006 - academia.eduhttps://www.academia.edu/download/51949954/1355.pdf Immobilized thermolysin for highly efficient production of low-molecular-weight protamine-An attractive cell-penetrating peptide for macromolecular drug delivery AE David , J Gong, B Chertok - Research Part A, 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jbm.a.33244KIAA0515 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0515 antibody, catalog no. 70R-3603Purity:Min. 95%EGF Receptor Peptide Acetate
EGFR Peptide Acetate (96249-43-3), a cell surface receptor tyrosine kinase, activates upon ligand binding.Formula:C63H97N13O25Purity:98.81%Color and Shape:SolidMolecular weight:1436.52Ref: TM-T21723L
1mg48.00€2mg62.00€5mg115.00€10mg187.00€25mg271.00€50mg408.00€100mg603.00€1mL*10mM (DMSO)283.00€Dynorphin A acetate(80448-90-4 free base)
Dynorphin A acetate is an Endogenous kappa receptor agonist.Formula:C101H159N31O25Purity:99.69%Color and Shape:SolidMolecular weight:2207.58TAPI-1
Peptide TAPI-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using TAPI-1 include the following: The interaction between Alzheimer amyloid beta (1-40) peptide and ganglioside GM1-containing membranes WK Surewicz - FEBS letters, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014579396015049 Effects of rectal administration of taurocholic acid on glucagon-like peptide-1 and peptide YY secretion in healthy humans T Wu , MJ Bound , SD Standfield - Diabetes, Obesity , 2013 - Wiley Online Libraryhttps://dom-pubs.onlinelibrary.wiley.com/doi/abs/10.1111/dom.12043 Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor T Ohtaki, Y Shintani, S Honda, H Matsumoto, A Hori - Nature, 2001 - nature.comhttps://www.nature.com/articles/35079135 The alpha-to-beta conformational transition of Alzheimer's Abeta-(1-42) peptide in aqueous media is reversible: a step by step conformational analysis suggests the location of S Tomaselli, V Esposito, P Vangone - , 2006 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.200500223 Gastrointestinal satiety signals III. Glucagon-like peptide 1, oxyntomodulin, peptide YY, and pancreatic polypeptide S Stanley , K Wynne , S Bloom - American Journal of , 2004 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpgi.00536.2003 Intracellular traffic and fate of protein transduction domains HIV-1 TAT peptide and octaarginine. Implications for their utilization as drug delivery vectors S Al-Taei, NA Penning, JC Simpson - Bioconjugate , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc050274h Full spectroscopic tip-enhanced Raman imaging of single nanotapes formed from beta-amyloid (1-40) peptide fragments M Paulite, C Blum, T Schmid , L Opilik, K Eyer - ACS , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/nn305677k Two types of Alzheimer's beta-amyloid (1-40) peptide membrane interactions: aggregation preventing transmembrane anchoring versus accelerated surface fibril M Bokvist, F Lindström, A Watts , G Gröbner - Journal of molecular biology, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283603014682 Insight Into the Kinetic of Amyloid beta (1-42) Peptide Self-Aggregation: Elucidation of Inhibitors' Mechanism of Action M Bartolini , C Bertucci, ML Bolognesi , A Cavalli - , 2007 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.200700427 Generation of human T-cell responses to an HLA-A2. 1-restricted peptide epitope derived from alpha-fetoprotein LH Butterfield , A Koh, W Meng , CM Vollmer , A Ribas - Cancer research, 1999 - AACRhttps://aacrjournals.org/cancerres/article-abstract/59/13/3134/505242 A peptide inhibitor of HIV-1 assembly in vitro J Sticht, M Humbert , S Findlow , J Bodem - Nature structural & , 2005 - nature.comhttps://www.nature.com/articles/nsmb964 Molecular dynamics simulations suggest a mechanism for translocation of the HIV-1 TAT peptide across lipid membranes HD Herce , AE Garcia - of the National Academy of Sciences, 2007 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0706574105 Structure of amyloid A4-(1-40)-peptide of Alzheimer's disease H Sticht , P Bayer, D Willbold , S Dames - European Journal of , 1995 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1432-1033.1995.293_1.x Crystal structures of the endoplasmic reticulum aminopeptidase-1 (ERAP1) reveal the molecular basis for N-terminal peptide trimming G Kochan , T Krojer , D Harvey - Proceedings of the , 2011 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1101262108 Thrombospondin-1 mimetic peptide inhibitors of angiogenesis and tumor growth: design, synthesis, and optimization of pharmacokinetics and biological activities F Haviv, MF Bradley, DM Kalvin - Journal of medicinal , 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm0401560 Adsorption of amyloid beta (1-40) peptide at phospholipid monolayers E Maltseva, A Kerth, A Blume, H Möhwald - , 2005 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.200500116 LX4211 increases serum glucagon-like peptide 1 and peptide YY levels by reducing sodium/glucose cotransporter 1 (SGLT1)-mediated absorption of intestinal DR Powell , M Smith, J Greer, A Harris, S Zhao - of Pharmacology and , 2013 - ASPEThttps://jpet.aspetjournals.org/content/345/2/250.short Fel d 1-derived peptide antigen desensitization shows a persistent treatment effect 1 year after the start of dosing: a randomized, placebo-controlled study D Patel, P Couroux, P Hickey, AM Salapatek - Journal of Allergy and , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674912012067 Effects of age on concentrations of plasma cholecystokinin, glucagon-like peptide 1, and peptide YY and their relation to appetite and pyloric motility CG MacIntosh, JM Andrews , KL Jones - The American journal of , 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0002916522043969 Co-localisation and secretion of glucagon-like peptide 1 and peptide YY from primary cultured human L cells AM Habib , P Richards , GJ Rogers, F Reimann - Diabetologia, 2013 - Springerhttps://link.springer.com/article/10.1007/s00125-013-2887-z Secondary structure conversions of Alzheimer's Abeta (1-40) peptide induced by membrane-mimicking detergents A Wahlström, L Hugonin, A Peralvarez-MaracaÂn - The FEBS , 2008 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1742-4658.2008.06643.xSF3B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B1 antibody, catalog no. 70R-4704Purity:Min. 95%H-VSEHFSLLF-OH
Peptide H-VSEHFSLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VSEHFSLLF-OH include the following: MHC-I-restricted epitopes conserved among variola and other related orthopoxviruses are recognized by T cells 30 years after vaccination ST Tang, M Wang , K Lamberth, M Harndahl- Archives of ..., 2008 - Springerhttps://link.springer.com/article/10.1007/s00705-008-0194-7