Peptides

Peptide H-GLMWLSYFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLMWLSYFV-OH include the following: T-cell immunity of SARS-CoV: Implications for vaccine development against MERS-CoV WJ Liu , M Zhao, K Liu, K Xu, G Wong, W Tan , GF Gao - Antiviral research, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166354216304016 Viral immunogenic footprints conferring T cell cross-protection to SARS-CoV-2 and its variants EC Antonio, MR Meireles, MAS Bragatte - Frontiers in , 2022 - frontiersin.orghttps://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2022.931372 Can the protection be among us? Previous viral contacts and prevalent HLA alleles could be avoiding an even more disseminated COVID-19 pandemic EC Antonio, MR Meireles, MA de Souza Bragatte - medRxiv, 2020 - medrxiv.orghttps://www.medrxiv.org/content/10.1101/2020.06.15.20131987.abstract Can the protection be among us? Previous viral contacts and prevalent HLA alleles avoiding an even more disseminated COVID-19 pandemic. EC Antonio, MR Meireles, MA de Souza Bragatte - 2020 - scholar.archive.orghttps://scholar.archive.org/work/tec7jzcl6faqjcpjymy6skokba/access/wayback/https://www.medrxiv.org/content/medrxiv/early/2020/08/25/2020.06.15.20131987.full.pdf Immunological interactions of virus peptides at the antigen presenting MHC I proteins A Rashidian - Bioinformatics, 2018 - utupub.fihttps://www.utupub.fi/bitstream/handle/10024/146525/Rashidian_Azam_Thesis.pdf?sequence=1

A synthetic peptide for use as a blocking control in assays to test for specificity of RNASE11 antibody, catalog no. 70R-5391

A synthetic peptide for use as a blocking control in assays to test for specificity of KEAP1 antibody, catalog no. 20R-1096

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SQIFSTASDNQPTVTIK^-OH include the following: Lectin BS-I inhibits cell migration and invasion via AKT/GSK-3beta/beta-catenin pathway in hepatocellular carcinoma Q Jian, Z Yang, J Shu , X Liu - Journal of cellular and , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/jcmm.13320 Identification of a potential tumor differentiation factor receptor candidate in prostate cancer cells I Sokolowska , AG Woods , MA Gawinowicz - The FEBS , 2012 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1742-4658.2012.08641.x Mass spectrometry for proteomics-based investigation of oxidative stress and heat shock proteins I Sokolowska , AG Woods , J Wagner - Oxidative stress , 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bk-2011-1083.ch013

A synthetic peptide for use as a blocking control in assays to test for specificity of RPL37 antibody, catalog no. 70R-10389

Peptide H-SSSPPVVTSSSHSRAPC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SSSPPVVTSSSHSRAPC-OH include the following: Sox3 expression identifies neural progenitors in persistent neonatal and adult mouse forebrain germinative zones TW Wang, GP Stromberg, JT Whitney - Journal of , 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/cne.20984 Adolescent binge alcohol exposure alters hippocampal progenitor cell proliferation in rats: effects on cell cycle kinetics JA McClain, DM Hayes, SA Morris - Journal of Comparative , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/cne.22647 Expression of Sox11 in adult neurogenic niches suggests a stage-specific role in adult neurogenesis A Haslinger, TJ Schwarz, M Covic - European Journal of , 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1460-9568.2009.06768.x

Peptide H-SFSLSTNLQESLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFSLSTNLQESLR-OH include the following: A sensitive and high-throughput LC-MS/MS method for the quantification of pegylated-interferon-alpha2a in human serum using monolithic C18 solid phase extraction for Z Yang, J Ke, M Hayes, M Bryant, LS Francis - Journal of Chromatography B, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157002320900302X A selective and sensitive UPLC-ESI-MS/MS method for quantification of pegylated interferon Alfa-2b in human serum using signature peptide-based quantitation MB Kusuma, R Kashibhatta, SS Jagtap - of Chromatography B, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023221003640

Peptide DOTA-LRELHLNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using DOTA-LRELHLNNN-OH include the following: Highly specific recognition of denatured collagen by fluorescent peptide probes with the repetitive Gly-Pro-Pro and Gly-Hyp-Hyp sequences W Wei, D Li, X Cai, Z Liu, Z Bai, J Xiao - Journal of Materials Chemistry , 2020 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2020/tb/d0tb01691h Peptide probes with aromatic residues Tyr and Phe at the X position show high specificity for targeting denatured collagen in tissues W Wei, D Li, X Cai, Z Liu, Z Bai, J Xiao - ACS omega, 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsomega.0c04684 A Synthesis Platform for Temperature Responsive Star Polymers SJ Richard Jr - 2018 - engagedscholarship.csuohio.eduhttps://engagedscholarship.csuohio.edu/etdarchive/1068/ Asymmetric SIS membranes specifically loaded with exosomes through the modification of engineered recombinant peptides for guide bone regeneration S Ma, Y Zhao, Y Yang, Y Mu, L Zhang, J Wu - Composites Part B , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1359836821009379 Synthetic peptides derived from decorin as building blocks for biomaterials based on supramolecular interactions S Federico - 2011 - publishup.uni-potsdam.dehttps://publishup.uni-potsdam.de/frontdoor/index/index/docId/5755 A SYNTHESIS PLATFORM FOR TEMPERATURE RESPONSIVE STAR POLYMERS RJ Schmitt Jr - 2018 - rave.ohiolink.eduhttps://rave.ohiolink.edu/etdc/view?acc_num=csu1530273120914017 Recent progress in the molecular imaging of nonalcoholic fatty liver disease O Wegrzyniak, M Rosestedt, O Eriksson - International Journal of , 2021 - mdpi.comhttps://www.mdpi.com/1422-0067/22/14/7348 Radiotracers for Imaging of Fibrosis: Advances during the Last Two Decades and Future Directions O Eriksson , I Velikyan - Pharmaceuticals, 2023 - mdpi.comhttps://www.mdpi.com/1424-8247/16/11/1540 In Vivo Imaging of the Pancreas and Gut Hormone Receptors O Eriksson , G Hulsart-Billström , B Mitran, E Puuvuori - 2022 - books.rsc.orghttps://books.rsc.org/books/edited-volume/2010/chapter/4592584 Radiolabelling and positron emission tomography imaging of a high-affinity peptide binder to collagen type 1 M Rosestedt, I Velikyan, U Rosenström - Nuclear Medicine and , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0969805120302997 Highly specific imaging of pathological type I collagen in connective tissues by dual SERS peptide probes L Nian, W Li, M Dai, C Zhang, L Li, G Zhang - Sensors and Actuators B , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0925400524001953 Designing Collagen-Binding Peptide with Enhanced Properties Using Hydropathic Free Energy Predictions K Boone , AK Cloyd, E Derakovic, P Spencer - Applied Sciences, 2023 - mdpi.comhttps://www.mdpi.com/2076-3417/13/5/3342 Biomimetic peptide nanoparticles participate in natural coagulation for hemostasis and wound healing HG Xu, QL Liang, L Li, GF Qi, L Wang, LN Zhan - Biomaterials , 2022 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2022/bm/d2bm00065b Targeting collagen for diagnostic imaging and therapeutic delivery H Wahyudi , AA Reynolds, Y Li, SC Owen - Journal of Controlled , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365916300062 Collagen-binding peptide-enabled supramolecular hydrogel design for improved organ adhesion and sprayable therapeutic delivery CF Anderson , RW Chakroun , ME Grimmett - Nano , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.nanolett.2c00967 Undersökning om aminosyran paca¥ position 6 i peptidkedjan LRELHLNNN ar viktig vid inbindning till kollagen I och för utveckling av ny fibrosdiagnostik. BE Bajat - 2020 - diva-portal.orghttps://www.diva-portal.org/smash/record.jsf?pid=diva2:1435977

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPBAP1 antibody, catalog no. 70R-8374

PHM-27 is a peptide that is used as a research tool in the fields of cell biology, pharmacology and immunology. It is also used to study protein interactions and receptor/ligand interactions.

Hepcidin, also known as LEAP-1 (liver-expressed antimicrobial peptide) or Hepcidin-25 is a hormone of 25 amino acids. Hepcidin is a cationic, cysteine-rich and tightly folded peptide stabilized by 4 disulfide bonds that plays a major role in innate immunity and iron homeostasis. Hepcidin inhibits iron transport by binding to the iron export channel ferroportin which is located on the basolateral surface of gut enterocytes and the plasma membrane of reticuloendothelial cells (macrophages). Hepcidin breaks down the transporter protein in the lysosome. Inhibiting ferroportin prevents iron exportation and iron is retained in cells. Hepcidin is regulated by iron through a complex of integral hemochromatosis proteins, like HFE, HJV and transferrin receptor 2. Hepcidin is also characterized by is antimicrobial activity in several vertebrate species, exerting its antimicrobial effect against both Gram-positive and Gram-negative bacteria as well as yeast, with for example an IC50 value against Saccharomyces cerevisae of 18 µM.

A synthetic peptide for use as a blocking control in assays to test for specificity of QTRT1 antibody, catalog no. 70R-2965

Peptide H-MTSAIGILPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-MTSAIGILPV-OH include the following: Peptide super-agonist enhances T-cell responses to melanoma SAE Galloway, G Dolton , M Attaf, A Wall - Frontiers in , 2019 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2019.00319/full

Peptide H-STQAAIDQINGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-STQAAIDQINGK^-OH include the following: Quantification of influenza virus hemagglutinins in complex mixtures using isotope dilution tandem mass spectrometry TL Williams, L Luna, Z Guo, NJ Cox, JL Pirkle - Vaccine, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X08003022 Simultaneous quantification of hemagglutinin and neuraminidase of influenza virus using isotope dilution mass spectrometry TL Williams, JL Pirkle, JR Barr - Vaccine, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X11019918

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW8 antibody, catalog no. 70R-9336

GLP-2 is a gut peptide that belongs to the glucagon-like peptide family. It is produced by K cells in the ileum and colon, and also by L cells in the stomach. GLP-2 is composed of 31 amino acids, has a molecular weight of 3,000 daltons, and has an amino acid sequence that is highly conserved among species. The EIA kit for human GLP-2 (GLP-2 Human) is designed to detect the presence of GLP-2 in samples from human serum or plasma.

Peptide H-GLEWV^AEI^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLEWV^AEI^R-OH include the following: Comparison of middle-and bottom-up mass spectrometry in forced degradation studies of bevacizumab and infliximab YFK Dyck, D Rehm, K Winkler, V Sandig, W Jabs - of pharmaceutical and , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708523003655 Analysis of tryptic peptides from therapeutic monoclonal antibodies using LC-MS/MS MAV Willrich - LC-MS in Drug Analysis: Methods and Protocols, 2019 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-8823-5_9 Six-step workflow for the quantification of therapeutic monoclonal antibodies in biological matrices with liquid chromatography mass spectrometry-a tutorial M El Amrani, AAM Donners, CE Hack - Analytica chimica , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267019306919 Bottom-up sample preparation for the LC-MS/MS quantification of anti-cancer monoclonal antibodies in bio matrices KAM de Jong, SJ van Breugel , MJX Hillebrand - Bioanalysis, 2020 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2020-0204 A generic approach for LC-MS/MS bioanalysis of therapeutic monoclonal antibodies in body fluids JH Toersche, AJ Kleinnijenhuis - Journal of Applied , 2015 - jab.scholasticahq.comhttps://jab.scholasticahq.com/article/436.pdf An automated mass spectrometric blood test for therapeutic drug monitoring of infliximab JG van der Gugten , B Bressler, ML DeMarco - Clinical Mass Spectrometry, 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2376999818300291 MSACL 2023 Abstract (s) for Proteomics D Qasrawi - msacl.orghttps://www.msacl.org/program/view_abstract_selection.php?topic=Proteomics&event=2023 A generic sample preparation approach for LC-MS/MS bioanalysis of therapeutic monoclonal antibodies in serum applied to Infliximab AJ Kleinnijenhuis , JH Toersche - Journal of Applied , 2015 - researchgate.nethttps://www.researchgate.net/profile/Frederique-Van-Holthoon/publication/273312071_A_generic_sample_preparation_approach_for_LC-MSMS_bioanalysis_of_therapeutic_monoclonal_antibodies_in_serum_applied_to_Infliximab/links/5654340508aefe619b19bbc4/A-generic-sample-preparation-approach-for-LC-MS-MS-bioanalysis-of-therapeutic-monoclonal-antibodies-in-serum-applied-to-Infliximab.pdf

Deoxyribonuclease I Bovine is an enzyme extracted from pancreas, thymus, or bovine tissue culture. It may be used to digest proteins in order to remove damaged linkages and produce a soluble protein-free extract. Deoxyribonuclease I Bovine can also be used for the removal of DNA from cells, tissues, and organs for biochemical methods such as biochemical assays, immunoassays, and nucleic acid amplification.

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Peptide H-V^IFDANAPVAV^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-V^IFDANAPVAV^R^-OH include the following: Thyroglobulin and thyroid cancer WS Phipps, AN Hoofnagle , MY Roth, CM Shuford - Cancer Biomarkers, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780128243022000060 Klinisyenler Ä°aca§in Tiroglobulin aca–laca§um Yöntemleri UA Gaca–KSU - GaziosmanpaÃ…Åža universitesi Tıp Fakultesi Dergisi, 2021 - dergipark.org.trhttps://dergipark.org.tr/en/pub/gutfd/issue/65466/1011845 Antibody based affinity capture LC-MS/MS in quantitative determination of proteins in biological matrices TG Halvorsen , L Reubsaet - TrAC Trends in Analytical Chemistry, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165993617301784 Precision of heavy-light peptide ratios measured by MALDI-TOF mass spectrometry NL Anderson , M Razavi, TW Pearson - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr201092v A novel mass spectrometry-based assay for the accurate measurement of thyroglobulin from patient samples containing antithyroglobulin autoantibodies NJ Clarke , Y Zhang, RE Reitz - Journal of Investigative , 2012 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.2310/JIM.0b013e318276deb4 Measurement of thyroglobulin by LC-MS/MS in serum and plasma in presence of anti-thyroglobulin autoantibodies MM Kushnir, AL Rockwood, WL Roberts - Clinical , 2013 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4016991/ Measurement of thyroglobulin by liquid chromatography-tandem mass spectrometry in serum and plasma in the presence of antithyroglobulin autoantibodies MM Kushnir, AL Rockwood, WL Roberts - Clinical , 2013 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/59/6/982/5621949 Liquid chromatography mass spectrometry based characterization of epitope configurations MCS LevernacaŠs, AU Moe, SL Boe, E Paus - Analytical , 2020 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2020/ay/d0ay01283a Influence of Thyroglobulin (Tg) Autoantibodies on Tg levels Measured by Different Methodologies:(IMA, LC-MS/MS and RIA) I Petrovic, J LoPresti, S Fatemi - The Journal of , 2024 - academic.oup.comhttps://academic.oup.com/jcem/advance-article-abstract/doi/10.1210/clinem/dgae286/7659925 Serum thyroglobulin evaluation on LC-MS/MS and immunoassay in TgAb-positive patients with papillary thyroid carcinoma E Nishihara, Y Hobo, A Miyauchi, Y Ito - European Thyroid , 2022 - etj.bioscientifica.comhttps://etj.bioscientifica.com/view/journals/etj/11/1/ETJ-21-0041.xml First Steps Toward Harmonization of LC-MS/MS Thyroglobulin Assays To the Editor DI TgIA, B Coulter - Clinical Chemistry, 2016 - researchgate.nethttps://www.researchgate.net/profile/Stefan-Grebe/publication/282425553_First_Steps_toward_Harmonization_of_LC-MSMS_Thyroglobulin_Assays/links/5645f67108ae9f9c13e7295b/First-Steps-toward-Harmonization-of-LC-MS-MS-Thyroglobulin-Assays.pdf First steps toward harmonization of LC-MS/MS thyroglobulin assays BC Netzel, RP Grant, AN Hoofnagle - Clinical , 2016 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/62/1/297/5611812 Epitopfisking og LC-MS i bestemmelse av tyreoglobulin-Kan LC-MS brukes til karakterisering av epitopkonfigurasjon? AU Moe - 2018 - duo.uio.nohttps://www.duo.uio.no/bitstream/handle/10852/63517/8/1805015-Masteroppgave-PDF.pdf Improving the measurement of serum thyroglobulin with mass spectrometry AN Hoofnagle , MY Roth - The Journal of Clinical Endocrinology , 2013 - academic.oup.comhttps://academic.oup.com/jcem/article-abstract/98/4/1343/2536676 Quantification of thyroglobulin, a low-abundance serum protein, by immunoaffinity peptide enrichment and tandem mass spectrometry AN Hoofnagle , JO Becker, MH Wener - Clinical , 2008 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/54/11/1796/5628645 Insights into the posttranslational structural heterogeneity of thyroglobulin and its role in the development, diagnosis, and management of benign and malignant ACW Xavier, RMB Maciel , JGH Vieira - of endocrinology and , 2016 - SciELO Brasilhttps://www.scielo.br/j/aem/a/fVwmt5dfKjxwxXgjJJxgM7H/?lang=en Rapid and accurate quantitation of thyroglobulin biomarkers using the Echo® MS+ system with ZenoTOF 7600 system A Stella, JW McCabe, A Bhalkikar - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/biopharma/MKT-31267-A_Rapid_peptide_quant_FINAL_KAW_JM_APS_v4_JK.pdf Automated, rapid method optimization and buffer screening using the Echo® MS+ system with ZenoTOF 7600 system A Stella, JW McCabe, A Bhalkikar - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/pharma/MKT-30777-1_Automated_%20rapid_method_optimization_and_buffer_screening_using_the_Echo_MS_system_with_ZenoTOF_7600_system_Final.pdf Antibody Characterization for use in Clinical Mass Spectrometry A Moore - 2018 - digital.lib.washington.eduhttps://digital.lib.washington.edu/researchworks/handle/1773/42880 Thyroglobulin measurement in the management of patients with differentiated thyroid cancer A Algeciras-Schimnich - Critical Reviews in Clinical Laboratory , 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/10408363.2018.1450830

Peptide H-ITLWQRPLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ITLWQRPLV-OH include the following: Supplemental Table 1. List of HIV class I peptides. M End - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/ed0f/0f087694817c860c5aad97fab618403c2847.pdf HLA-A* 68: 02-restricted Gag-specific cytotoxic T lymphocyte responses can drive selection pressure on HIV but are subdominant and ineffective HN Kloverpris , A Stryhn, M Harndahl, JM Carlson - Aids, 2013 - journals.lww.comhttps://journals.lww.com/aidsonline/fulltext/2013/07170/HLA_A_68_02_restricted_Gag_specific_cytotoxic_T.4.aspx

Catalogue peptide; min. 95% purity

Peptide H-RPHFPQFSYSASSTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RPHFPQFSYSASSTA-NH2 include the following: Efficient and cost effective production of active-form human PKB using silkworm larvae R Maesaki, R Satoh, M Taoka , T Kanaba, T Asano - Scientific reports, 2014 - nature.comhttps://www.nature.com/articles/srep06016

A synthetic peptide for use as a blocking control in assays to test for specificity of SDHB antibody, catalog no. 70R-2436

Catalogue peptide; min. 95% purity

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-QKSDDDYEDYASNKTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QKSDDDYEDYASNKTC-NH2 include the following: Quantitative Immunoprecipitation Studies with Anti-γ-Aminobutyric AcidA Receptor γ2 1-15 Cys Antibodies MJ Duggan, S Pollard - Journal of , 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1471-4159.1992.tb09278.x

GRGD-acid is a cell adhesive peptide containing the RGD motif. This enables it the ability to increase cell adhesion and rates of cell growth, differentiation and proliferation.When immobilised onto a Poly(etheretherketone) (PEEK) surface it has been shown to increase cell adhesion and proliferation in MC3T3-E1 cells. GRGD could therefore be used in dental implants.This peptide contains a C-terminal Alexa Fluor 647 florescent dye. A cysteine residue has been added to the C-terminus for conjugation of the dye via the cysteine thiol moiety. AF647 is a bright, far-red-fluorescent dye with excitation between 594 nm and 633 nm, and is pH-insensitive over a wide molar range.

Peptide Fluor-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Fluor-LMKNMDPLNDNV-NH2 include the following: Natural IgM blockade limits infarct expansion and left ventricular dysfunction in a swine myocardial infarct model S Sihag, MS Haas, KM Kim, JL Guerrero - Circulation , 2016 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/CIRCINTERVENTIONS.115.002547 Blockade of self-reactive IgM significantly reduces injury in a murine model of acute myocardial infarction MS Haas, EM Alicot, F Schuerpf, I Chiu - Cardiovascular , 2010 - academic.oup.comhttps://academic.oup.com/cardiovascres/article-abstract/87/4/618/321181 Myocardial Infarction MI Model - 2015 - Am Heart Assochttps://www.ahajournals.org/doi/download-pdf-zip/10.1161/CIRCINTERVENTIONS.115.002547 Attenuation of the effects of rat hemorrhagic shock with a reperfusion injury-inhibiting agent specific to mice C Ahmadi-Yazdi, B Williams , S Oakes, FD Moore Jr - Shock, 2009 - journals.lww.comhttps://journals.lww.com/shockjournal/fulltext/2009/09000/Transient_Receptor_Potential_Vanilloid_1.00011.aspx

Gut tetradecapeptide with the ability to stimulate release of various hormones This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Pepinh-TRIF TFA is a 30 aa peptide associated with the immune system that blocks TRIF signaling by interfering with TLR-TRIF interaction (TLR-TRIF interaction

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of PAF1 antibody, catalog no. 70R-10322

A synthetic peptide for use as a blocking control in assays to test for specificity of PPIL3 antibody, catalog no. 70R-2932

Catalogue peptide; min. 95% purity

Peptide LCBiot-IAGEASRLAHYNKRSTITSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-IAGEASRLAHYNKRSTITSR-OH include the following: A metabolomics-inspired strategy for the identification of protein covalent modifications J Nunes , C Charneira, C Nunes - Frontiers in , 2019 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fchem.2019.00532/full

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Influenza B native 5-peptide mixture of: H-SHFANLK-OHH-SYFANLK-OHH-GVLLPQK-OHH-NLNSLSELEVK-OHH-GILLPQK-OHAAA: Concentration - Duplicate 100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquots

Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FLRGRAYGL^-OH include the following: In Vitro Studies of MHC Class I Peptide Loading and Exchange M Bouvier - Antigen Processing: Methods and Protocols, 2019 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-9450-2_6 T-cell receptor binding affects the dynamics of the peptide/MHC-I complex B Knapp , CM Deane - Journal of Chemical Information and ..., 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jcim.5b00511 A structural basis for varied αβ TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule S Gras , PG Wilmann, Z Chen, H Halim- The Journal of ..., 2012 - journals.aai.orghttps://journals.aai.org/jimmunol/article/188/1/311/39100 Insights into the structure of the LC13 TCR/HLA-B8-EBV peptide complex with molecular dynamics simulations A Stavrakoudis - Cell biochemistry and biophysics, 2011 - Springerhttps://link.springer.com/article/10.1007/s12013-011-9151-2 A Structural Basis for Varied SRB Purcell, J McCluskey , J Halim, YC Liu- 2011 - academia.eduhttps://www.academia.edu/download/49937131/311.full.pdf Preferential binding of unusually long peptides to MHC class I and its influence on the selection of target peptides for T cell recognition JM Burrows, MJ Bell, R Brennan, JJ Miles - Molecular ..., 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589007007870 Amino acid 95 causes strong alteration of peptide position PΩ in HLA-B* 41 variants C Bade-Doeding, DS DeLuca , A Seltsam, R Blasczyk - Immunogenetics, 2007 - Springerhttps://link.springer.com/article/10.1007/s00251-007-0197-7 Analysis of interactions in a tapasin/class I complex provides a mechanism for peptide selection M Chen , M Bouvier - The EMBO journal, 2007 - embopress.orghttps://www.embopress.org/doi/abs/10.1038/sj.emboj.7601624 The structure of the human allo-ligand HLA-B* 3501 in complex with a cytochrome p450 peptide: Steric hindrance influences TCR allo-recognition CS Hourigan , M Harkiolaki , NA Peterson- European journal of ..., 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.200636234 Alloreactivity between disparate cognate and allogeneic pMHC-I complexes is the result of highly focused, peptide-dependent structural mimicry JK Archbold , WA Macdonald , JJ Miles - Journal of Biological ..., 2006 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)70616-2/fulltext Antagonism of antiviral and allogeneic activity of a human public CTL clonotype by a single altered peptide ligand: implications for allograft rejection LK Ely, KJ Green, T Beddoe , CS Clements- The Journal of ..., 2005 - journals.aai.orghttps://journals.aai.org/jimmunol/article/174/9/5593/72504 T cell receptor recognition of a'super-bulged'major histocompatibility complex class I-bound peptide FE Tynan, SR Burrows , AM Buckle , CS Clements- Nature ..., 2005 - nature.comhttps://www.nature.com/articles/ni1257 Novel strategy for identification of candidate cytotoxic T-cell epitopes from human preproinsulin L Chang, L Kjer-Nielsen, S Flynn, AG Brooks - Tissue ..., 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-0039.2003.00122.x Cutting edge: the minor histocompatibility antigen H60 peptide interacts with both H-2Kb and NKG2D A Cerwenka, CA O'Callaghan- The Journal of ..., 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/168/7/3131/34975 The structure of HLA-B8 complexed to an immunodominant viral determinant: peptide-induced conformational changes and a mode of MHC class I dimerization L Kjer-Nielsen, CS Clements, AG Brooks - The Journal of ..., 2002 - journals.aai.orghttps://journals.aai.org/jimmunol/article/169/9/5153/75164 The production, purification and crystallization of a soluble heterodimeric form of a highly selected T-cell receptor in its unliganded and liganded state CS Clements, L Kjer-Nielsen- Section D: Biological ..., 2002 - journals.iucr.orghttps://journals.iucr.org/d/issues/2002/12/00/cy0066/cy0066.pdf Peptide-MHC class I tetrameric complexes display exquisite ligand specificity SR Burrows , N Kienzle, A Winterhalter- The Journal of ..., 2000 - journals.aai.orghttps://journals.aai.org/jimmunol/article/165/11/6229/33743 The relationship between the cell surface density and the immunogenicity of multiple Epstein-Barr virus epitopes VL Crotzer - 2000 - search.proquest.comhttps://search.proquest.com/openview/06a0758b23e4b23671968815a6781078/1?pq-origsite=gscholar&cbl=18750&diss=y Induction of Epstein-Barr virus-specific cytotoxic T-lymphocyte responses using dendritic cells pulsed with EBNA-3A peptides or UV-inactivated, recombinant EBNA M Subklewe, A Chahroudi - Blood, The Journal ..., 1999 - ashpublications.orghttps://ashpublications.org/blood/article-abstract/94/4/1372/249676 Differences in the recognition by CTL of peptides presented by the HLA-B* 4402 and the HLA-B* 4403 molecules which differ by a single amino acid J Herman, V Jongeneel , D Kuznetsov- Tissue ..., 1999 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-0039.1999.530201.x The immunostimulatory effect of bio-active peptide from pollen on murine and human lymphocytes J Liu, S Wang, J Qi, X Wang, Y Song - Mechanisms of ageing and ..., 1998 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0047637498000633 Human leukocyte antigen phenotype imposes complex constraints on the antigen-specific cytotoxic T lymphocyte repertoire SR Burrows , SL Silins, SM Cross- European journal of ..., 1997 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830270126 -Barr virus augment the alloresponse to common human leukocyte antigens: degenerate recognition of major histocompatibility complex-bound peptide by T cells SR Burrows , SL Silins, R Khanna - European journal of ..., 1997 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830270720 T cell receptor repertoire for a viral epitope in humans is diversified by tolerance to a background major histocompatibility complex antigen. SR Burrows , SL Silins, DJ Moss, R Khanna - The Journal of ..., 1995 - rupress.orghttps://rupress.org/jem/article-abstract/182/6/1703/25482 Endoplasmic reticulum signal sequence facilitated transport of peptide epitopes restores immunogenicity of an antigen processing defective tumour cell line R Khanna , SR Burrows , V Argaet- International ..., 1994 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/6/4/639/714413 The specificity of recognition of a cytotoxic T lymphocyte epitope SR Burrows , SJ Rodda, A Suhrbier - European journal of ..., 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.1830220128 Rapid visual assay of cytotoxic T-cell specificity utilizing synthetic peptide induced T-cell-T-cell killing. SR Burrows , A Suhrbier , R Khanna , DJ Moss - Immunology, 1992 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC1421752/ Inhibition of HLA B8-restricted recognition by unrelated peptides: evidence for allosteric inhibition A Fernan, SR Burrows , DJ Moss, A Saul , A Suhrbier - Immunology letters, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016524789190048F

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Histone H3 (1-20) K4Me3-GG-[Lys(5-FAM)] is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.The lysine at position 4 of this peptide has been tri-methylated and it is implicated in studies that this modification may remodel the chromatin so that it is more accessible to transcription factors, which may ultimately increase the level of gene expression.Additionally, Histone H3 (1-20) K4Me3-GG-[Lys(5-FAM)] has a C-terminal GKK linker labelled with 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag. This peptide also has an uncharged C-terminal amide.

Leptin (116-130), mouse C64H109N19O24S, controls appetite and energy, sequence SCSLPQTSGLQKPES-NH2.

Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM109 antibody, catalog no. 70R-1901

Peptide H-SQLLNAKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SQLLNAKYL-OH include the following: Highly focused TCR Vbeta repertoire is associated with a large number of naive precursors and robust CD8 T cell responses specific for a Plasmodium antigen (IRM14P V Braeckel-Budimir, J Harty - The Journal of Immunology, 2015 - journals.aai.orghttps://journals.aai.org/jimmunol/article/194/1_Supplement/198.10/55554 The Deubiquitinating Enzyme Cylindromatosis Dampens CD8+ T Cell Responses and Is a Critical Factor for Experimental Cerebral Malaria and Blood-Brain Barrier U Schmid, W Stenzel, J Koschel, M Raptaki - Frontiers in , 2017 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2017.00027/full Co-infection with Chikungunya virus alters trafficking of pathogenic CD8+ T cells into the brain and prevents Plasmodium-induced neuropathology TH Teo , SW Howland , C Claser , SY Gun - EMBO Molecular , 2018 - embopress.orghttps://www.embopress.org/doi/abs/10.15252/emmm.201707885 Investigating proteasome inhibitors as potential adjunct therapies for experimental cerebral malaria SW Howland , GXP Ng, SK Chia - Parasite Immunology, 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/pim.12277 Brain microvessel cross-presentation is a hallmark of experimental cerebral malaria SW Howland , CM Poh, SY Gun, C Claser - EMBO molecular , 2013 - embopress.orghttps://www.embopress.org/doi/abs/10.1002/emmm.201202273 Activated brain endothelial cells cross-present malaria antigen SW Howland , CM Poh, L Renia - PLoS pathogens, 2015 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1004963 Unravelling mysteries at the perivascular space: a new rationale for cerebral malaria pathogenesis SC Wassmer , TF de Koning-Ward , GER Grau - Trends in Parasitology, 2023 - cell.comhttps://www.cell.com/trends/parasitology/fulltext/S1471-4922(23)00285-4 CD8+ T Cells Induce Fatal Brainstem Pathology during Cerebral Malaria via Luminal Antigen-Specific Engagement of Brain Vasculature PA Swanson, GT Hart , MV Russo , D Nayak - PLoS , 2016 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1006022 A Plasmodium Cross-Stage Antigen Contributes to the Development of Experimental Cerebral Malaria P Fernandes , SW Howland , K Heiss - Frontiers in , 2018 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2018.01875/full Doxycycline inhibits experimental cerebral malaria by reducing inflammatory immune reactions and tissue-degrading mediators KE Schmidt, JM Kuepper, B Schumak, J Alferink - PLoS , 2018 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0192717 Dendritic cell specific function of deubiquitinating enzyme OTUD7b in experimental cerebral malaria K Harit - 2024 - repo.bibliothek.uni-halle.dehttps://repo.bibliothek.uni-halle.de/handle/1981185920/117294 HVEM and CD160: regulators of immunopathology during malaria blood-stage F Muscate, N Stetter, C Schramm - Frontiers in , 2018 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2018.02611/full Targeting glutamine metabolism rescues mice from late-stage cerebral malaria EB Gordon , GT Hart , TM Tran - Proceedings of the , 2015 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1516544112 Damage to the Blood-Brain Barrier during Experimental Cerebral Malaria Results from Synergistic Effects of CD8+ T Cells with Different Specificities CM Poh, SW Howland , GM Grotenbreg - Infection and , 2014 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.02180-14 Spatiotemporal requirements for IRF7 in mediating type I IFN-dependent susceptibility to blood-stage Plasmodium infection CL Edwards, SE Best, SY Gun, C Claser - European journal of , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201444824 Antigen presentation by discrete class I molecules on brain endothelium dynamically regulates T-cell mediated neuropathology in experimental cerebral malaria CE Fain , J Zheng, F Jin, K Ayasoufi , Y Wu , MT Lilley - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.10.30.514412.abstract Inherently Reduced Expression of ASC Restricts Caspase-1 Processing in Hepatocytes and Promotes Plasmodium Infection C Marques-da-Silva , C Schmidt-Silva - The Journal of , 2024 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/doi/10.4049/jimmunol.2300440/266573 Brain endothelial cells exposure to malaria parasites links type I interferon signalling to antigen presentation, immunoproteasome activation, endothelium disruption AM Shafi, aca Vegvari , SW Howland - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2023.1149107/full Suppression of Plasmodium MIF-CD74 signaling protects against severe malaria AB Garcia, E Siu , X Du, L Leng - : official publication of , 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC9022605/

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK6 antibody, catalog no. 70R-5203

Bz-L-Arg-pNA • HCl is a protease inhibitor. It is a competitive inhibitor of bovine pancreatic trypsin, chymotrypsin, and elastase. Bz-L-Arg-pNA • HCl has also been shown to inhibit the growth of cancer cells in culture and to induce apoptosis. Bz-L-Arg-pNA • HCl binds to the active site of cathepsin and thiol proteases, inhibiting their activity by blocking peptide bond hydrolysis. This drug has been shown to inhibit proteolytic activation of proinflammatory cytokines such as IL1β, IL6, IL8, and TNFα.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

5-FAM SE, a single-isomer green fluorophore, labels peptides, proteins, nucleotides.

Peptide H-DLVFSTWDHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DLVFSTWDHK-OH include the following: Highly selective and sensitive LC-MS/MS quantification of a therapeutic protein in human serum using immunoaffinity capture enrichment Y Fu, W Li, J Flarakos - Journal of Chromatography B, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157002321830744X

A synthetic peptide for use as a blocking control in assays to test for specificity of PGK1 antibody, catalog no. 70R-2755

Peptide H-ISSPTETER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ISSPTETER^-OH include the following: Label-free selected reaction monitoring enables multiplexed quantitation of S100 protein isoforms in cancer cells J Martaca­nez-Aguilar , MP Molloy - Journal of proteome research, 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr400251t

Peptide H-FFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FFV-OH include the following: Mutagenesis of N-terminal residues of feline foamy virus Gag reveals entirely distinct functions during capsid formation, particle assembly, Gag processing and Y Liu, MJ Betts , J Lei , G Wei , Q Bao, T Kehl, RB Russell - Retrovirology, 2016 - Springerhttps://link.springer.com/article/10.1186/s12977-016-0291-8 Furin-mediated cleavage of the feline foamy virus Env leader protein V Geiselhart, P Bastone, T Kempf - Journal of , 2004 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.78.24.13573-13581.2004 Features of the Env leader protein and the N-terminal Gag domain of feline foamy virus important for virus morphogenesis V Geiselhart, A Schwantes, P Bastone, M Frech - Virology, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682203001259 Specific interaction of a novel foamy virus Env leader protein with the N-terminal Gag domain T Wilk, V Geiselhart, M Frech, SD Fuller - Journal of , 2001 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.75.17.7995-8007.2001 Computational Approaches to Understanding the Self-Assembly of Peptide-Based Nanostructures T Tuttle - Israel Journal of Chemistry, 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijch.201400188 Proteolytic processing of foamy virus Gag and Pol proteins RM Flugel, KI Pfrepper - Foamy Viruses, 2003 - Springerhttps://link.springer.com/chapter/10.1007/978-3-642-55701-9_3 Self-assembling bioactive peptides for gastrointestinal delivery-Bioinformatics-driven discovery and in vitro assessment N Petit , JM Dyer , M Richena - Journal of Food , 2024 - Wiley Online Libraryhttps://ifst.onlinelibrary.wiley.com/doi/abs/10.1111/ijfs.17002 Applications of self-assembling ultrashort peptides in bionanotechnology M Ni , S Zhuo - RSC advances, 2019 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2019/ra/c8ra07533f Optimisation of expression and purification of the feline and primate foamy virus transmembrane envelope proteins using a 96 deep well screen M Muhle, M Löchelt, J Denner - Protein Expression and Purification, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1046592811002531 Immunisation with foamy virus Bet fusion proteins as novel strategy for HIV-1 epitope delivery M Muhle, K Hoffmann, M Löchelt, J Denner - Immunologic research, 2013 - Springerhttps://link.springer.com/article/10.1007/s12026-013-8387-x Construction and characterisation of replicating foamy viral vectors expressing HIV-1 epitopes recognised by broadly neutralising antibodies M Muhle, K Hoffmann, M Löchelt, J Denner - Antiviral research, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166354213002556 Immunological properties of the transmembrane envelope protein of the feline foamy virus and its use for serological screening M Muhle, A Bleiholder, S Kolb, J Hubner, M Löchelt - Virology, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682211000377 Epitope mapping of the antibody response against the envelope proteins of the feline foamy virus M Muhle, A Bleiholder, M Löchelt, J Denner - Viral Immunology, 2017 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2016.0156 HIV-1 vaccine epitope delivery based on foamy viral hybrid proteins and vectors M Muhle - 2015 - edoc.rki.dehttps://edoc.rki.de/handle/176904/5414 The antiretroviral activity of APOBEC3 is inhibited by the foamy virus accessory Bet protein M Löchelt, F Romen, P Bastone - Proceedings of the , 2005 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0501445102 Neutralization of zoonotic retroviruses by human antibodies: Genotype-specific epitopes within the receptor-binding domain from simian foamy virus LT Dynesen, I Fernandez, Y Coquin - PLoS , 2023 - journals.plos.orghttps://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1011339 Foamy virus Bet fusion proteins for induction of neutralising antibodies against HIV-1 K Hoffmann - 2011 - edoc.rki.dehttps://edoc.rki.de/handle/176904/5369 Topography of a binding site for small amnestic peptides deduced from structure-activity studies: relation to amnestic effect of amyloid beta protein. JF Flood, E Roberts, MA Sherman - Proceedings of the , 1994 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.91.1.380 Replication-competent foamy virus vaccine vectors as novel epitope scaffolds for immunotherapy J Lei , W Osen, A Gardyan, A Hotz-Wagenblatt, G Wei - PLoS , 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0138458 Integrase C-terminal residues determine the efficiency of feline foamy viral DNA integration J Kim, GE Lee, M Lochelt, CG Shin - Virology, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682217303707 Immunising with the transmembrane envelope proteins of different retroviruses including HIV-1: a comparative study J Denner - Human vaccines & immunotherapeutics, 2013 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4161/hv.23221 Kinetic analysis of retroviral proteases H Eizert - 2013 - dea.lib.unideb.huhttps://dea.lib.unideb.hu/bitstreams/bf7ae59f-d8f0-4352-9b06-7d7e3c815e03/download Self-assembly and hydrogel formation ability of Fmoc-dipeptides comprising alpha-methyl-L-phenylalanine H Arakawa, K Takeda, SL Higashi , A Shibata - Polymer Journal, 2020 - nature.comhttps://www.nature.com/articles/s41428-019-0301-5 Single residue mutation in integrase catalytic core domain affects feline foamy viral DNA integration GE Lee, J Kim, CG Shin - Bioscience, Biotechnology, and , 2019 - academic.oup.comhttps://academic.oup.com/bbb/article-abstract/83/2/270/5955584 Establishment and evaluation of a feline foamy virus subviral particle-based vaccine strategy for induction of neutralizing antibodies against HIV-1 G Schneikart - 2014 - edoc.rki.dehttps://edoc.rki.de/handle/176904/5422 Aqueous amino acids and proteins near the surface of gold in hydrophilic and hydrophobic force fields G Nawrocki , M Cieplak - The Journal of Physical Chemistry C, 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jp5030558 Contributions of the structural domains of filensin in polymer formation and filament distribution G Goulielmos , S Remington - Journal of cell , 1996 - journals.biologists.comhttps://journals.biologists.com/jcs/article-abstract/109/2/447/24745 Crystal structure and supramolecular arrangement of heterochiral tripeptides G Dolai , RS Giri , S Roy , B Mandal - Peptide Science, 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/pep2.24229 Application of chimeric feline foamy virus-based retroviral vectors for the induction of antiviral immunity in cats A Schwantes, U Truyen , J Weikel, C Weiss - Journal of , 2003 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.77.14.7830-7842.2003 Construction and functional characterization of feline foamy virus-based retroviral vectors A Schwantes, I Ortlepp, M Löchelt - Virology, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682202915436 Prototype foamy virus envelope glycoprotein leader peptide processing is mediated by a furin-like cellular protease, but cleavage is not essential for viral infectivity A Duda, A Stange, D Lüftenegger, N Stanke - Journal of , 2004 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.78.24.13865-13870.2004

A synthetic peptide for use as a blocking control in assays to test for specificity of MCM4 antibody, catalog no. 70R-1599

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF5 antibody, catalog no. 70R-3190

A synthetic peptide for use as a blocking control in assays to test for specificity of RBJ antibody, catalog no. 70R-5875

Ceruletide Ammonium acetate (FI-6934 Ammonium acetate) is a cholecystokinin (CCK) receptor agonist.

A synthetic peptide for use as a blocking control in assays to test for specificity of UGT2B15 antibody, catalog no. 70R-7532

Peptide H-FGQGSGPIVLDDVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FGQGSGPIVLDDVR-OH include the following: A proteomic analysis of human bile TZ Kristiansen, J Bunkenborg , M Gronborg - Molecular & Cellular , 2004 - ASBMBhttps://www.mcponline.org/article/S1535-9476(20)33864-0/fulltext Human salivary agglutinin binds to lung surfactant protein-D and is identical with scavenger receptor protein gp-340 TJM LIGTENBERG, FJ BIKKER - Biochemical , 2001 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/359/1/243/38684 Quantitative analysis of differentially expressed saliva proteins in human immunodeficiency virus type 1 (HIV-1) infected individuals N Zhang, Z Zhang, S Feng, Q Wang, D Malamud - Analytica chimica , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267013002729 Identification of a nonmucin glycoprotein (gp-340) from a purified respiratory mucin preparation: evidence for an association involving the MUC5B mucin DJ Thornton , JR Davies, S Kirkham, A Gautrey - , 2001 - academic.oup.comhttps://academic.oup.com/glycob/article-abstract/11/11/969/716928

Peptide H-IL^DTAGR^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IL^DTAGR^EEY-OH include the following: Combined presentation and immunogenicity analysis reveals a recurrent RAS. Q61K neoantigen in melanoma A Peri , E Greenstein , M Alon, JA Pai - The Journal of , 2021 - Am Soc Clin Investighttps://www.jci.org/articles/view/129466

Catalogue peptide; min. 95% purity

Peptide H-LTLLAPLNSVFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LTLLAPLNSVFK^-OH include the following: Targeted expression of tgfbip peptides in mouse and human tissue by maldi-mass spectrometry imaging V Anandalakshmi, G Hochart, D Bonnel , J Stauber - Separations, 2021 - mdpi.comhttps://www.mdpi.com/2297-8739/8/7/97 Cancer serum atlas-supported precise pan-targeted proteomics enable multicancer detection A Hu, L Zhang, Z Wang, C Yuan, L Lin - Analytical , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.2c03299

Peptide H-LSGRSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LSGRSDNH-OH include the following: Generation and characterization of a target-selectively activated antibody against epidermal growth factor receptor with enhanced anti-tumor potency Y Yang, Q Guo, M Xia, Y Li, X Peng, T Liu, X Tong, J Xu - MAbs, 2015 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2015.1008352 Ab locks for improving the selectivity and safety of antibody drugs WW Lin, YC Lu, CH Chuang, TL Cheng - Journal of Biomedical Science, 2020 - Springerhttps://link.springer.com/article/10.1186/s12929-020-00652-z an der, Gram W Wulp - M., Blei le ens, B., Hagedoorn, RS , 2023 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A3656822/download Comparison of methods generating antibody-epitope conjugates for targeting cancer with virus-specific T cells W van der Wulp, AM Gram, B Bleijlevens - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2023.1183914/full Monitoring protease activity in biological tissues using antibody prodrugs as sensing probes O Vasiljeva , E Menendez, M Nguyen, CS Craik - Scientific reports, 2020 - nature.comhttps://www.nature.com/articles/s41598-020-62339-7 Protease-activation using anti-idiotypic masks enables tumor specificity of a folate receptor 1-T cell bispecific antibody M Geiger, KG Stubenrauch, J Sam, WF Richter - Nature , 2020 - nature.comhttps://www.nature.com/articles/s41467-020-16838-w/1000 In vivo imaging of protease activity by Probody therapeutic activation KR Wong, E Menendez, CS Craik , WM Kavanaugh - Biochimie, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0300908415003508 Tumor-responsive, multifunctional CAR-NK cells cooperate with impaired autophagy to infiltrate and target glioblastoma J Wang, S Toregrosa-Allen, BD Elzey , S Utturkar - BioRxiv, 2020 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2020.10.07.330043.abstract Conditionally activated affibody-based prodrug targeting EGFR demonstrates improved tumour selectivity CD Leitao , AM Borras , T Xu, M Oroujeni, Y Liu - Journal of Controlled , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365923002298 Tumor-conditional anti-CTLA4 uncouples antitumor efficacy from immunotherapy-related toxicity CCS Pai, DM Simons, X Lu, M Evans - The Journal of , 2019 - Am Soc Clin Investighttps://www.jci.org/articles/view/123391 Development of an Affibody-based Prodrug Against HER2 for Cancer Therapy C Westerberg - 2021 - diva-portal.orghttps://www.diva-portal.org/smash/record.jsf?pid=diva2:1595502 Novel ex vivo zymography approach for assessment of protease activity in tissues with activatable antibodies B Howng, MB Winter , C LePage, I Popova, M Krimm - Pharmaceutics, 2021 - mdpi.comhttps://www.mdpi.com/1999-4923/13/9/1390 Masking the immunotoxicity of interleukin-12 by fusing it with a domain of its receptor via a tumour-protease-cleavable linker A Mansurov , P Hosseinchi , K Chang - Nature Biomedical , 2022 - nature.comhttps://www.nature.com/articles/s41551-022-00888-0

A synthetic peptide for use as a blocking control in assays to test for specificity of PDPK1 antibody, catalog no. 70R-7831

Anti-microbial peptide (AMP) designed using only residues G, L, and K (GLK-19). Active against-Escherichia coli-with higher activity relative to human AMP LL-37 and also weakly active against methicillin-resistant Staphylococcus aureus (MRSA), but not-active against HIV-1. Activity against E. coli with a minimal inhibitory concentration (MIC) at 10 mM.

The Histone H3 (20-36)-K27Me3 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (20-36) lysine 27 has been trimethylated which is usually a marker of repressive chromatin. H3K27 trimethylation also prevents H3 from interacting with SET1-like complexes, thus inhibiting the trimethylation of H3K4.

Peptide H-QYIK^ANSK^FIGITEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QYIK^ANSK^FIGITEL-OH include the following: Immunization against leukemia inhibitory factor and its receptor suppresses tumor formation of breast cancer initiating cells in BALB/c mouse Z Ghanei, N Mehri , A Jamshidizad, MD Joupari - Scientific Reports, 2020 - nature.comhttps://www.nature.com/articles/s41598-020-68158-0 Antigen-specific T cells with monogamous or promiscuous restriction patterns are sensitive to different HLA-DR beta chain substitutions. RW Karr, P Panina-Bordignon, WY Yu - (Baltimore, Md.: 1950 , 1991 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/146/12/4242/23521 The fully synthetic glycopeptide MAG-Tn3 therapeutic vaccine induces tumor-specific cytotoxic antibodies in breast cancer patients P Rosenbaum, C Artaud, S Bay, C Ganneau - Cancer Immunology , 2020 - Springerhttps://link.springer.com/article/10.1007/s00262-020-02503-0 Characterization of expression, cytokine regulation, and effector function of the high affinity IgG receptor Fc gamma RI (CD64) expressed on human blood dendritic NA Fanger, D Voigtlaender, C Liu, S Swink - (Baltimore, Md.: 1950 , 1997 - journals.aai.orghttps://journals.aai.org/jimmunol/article-abstract/158/7/3090/30438 In silico and in vitro analysis of interaction between ximelagatran and human leukocyte antigen (HLA)-DRB1* 07: 01 M Hirasawa, K Hagihara, K Abe, O Ando - International journal of , 2017 - mdpi.comhttps://www.mdpi.com/1422-0067/18/4/694 Gamma delta T cell receptors confer autonomous responsiveness to the insulin-peptide B: 9-23 L Zhang, N Jin, M Nakayama, RL O'Brien - Journal of , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S089684110900167X T-cell recognition of prostatic peptides in men with chronic prostatitis/chronic pelvic pain syndrome DV Kouiavskaia, S Southwood, CA Berard - The Journal of , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022534709017960 Induction of protective antibodies in Saimiri monkeys by immunization with a multiple antigen construct (MAC) containing the Plasmodium vivax circumsporozoite C Yang, WE Collins, L Xiao , AM Saekhou, RC Reed - Vaccine, 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X97002004 Large-scale synthesis and structural analysis of a synthetic glycopeptide dendrimer as an anti-cancer vaccine candidate C Ganneau, C Simenel, E Emptas, T Courtiol - Organic & , 2017 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2017/ob/c6ob01931e Design of highly immunogenic liposomal constructs combining structurally independent B cell and T helper cell peptide epitopes C Boeckler, D Dautel, P Schelte - European journal of , 1999 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1521-4141(199907)29:07%3C2297::AID-IMMU2297%3E3.0.CO;2-5 Synthetic Peptide-Based Highly Immunogenic Liposomal Constructs B Frisch , A Roth, F Schuber - Methods in enzymology, 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0076687903730043 T-Cell Antigen and MHC Recognition: Molecular Analysis of Human alpha/beta TCR Specific for a Tetanus Toxin-Derived Peptide B Boitel, M Ermonval, U Blank, O Acuto - T Lymphocytes: Structure , 1992 - Springerhttps://link.springer.com/chapter/10.1007/978-1-4615-3054-1_1 T-CELL ANTIGEN AND MHC RECOGNITION: MOLECULAR ANALYSIS OF HUMAN TCR SPECIFIC FOR A TETANUS TOXIN-DERIVED PEPTIDE B Boitel, M Ermonval, U Blank, O Acuto - T Lymphocytes, 1992 - Springerhttps://link.springer.com/content/pdf/10.1007/978-1-4615-3054-1.pdf#page=12 V3 induces in human normal cell populations an accelerated macrophage-mediated proliferation-apoptosis phenomenon of effector T cells when they respond to their A Zafiropoulos , S Baritaki , M Sioumpara - Biochemical and , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X01943001 In silico analyses of heat shock protein 60 and calreticulin to designing a novel vaccine shifting immune response toward T helper 2 in atherosclerosis A Karkhah , M Saadi , HR Nouri - Computational biology and chemistry, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1476927116305898

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SPALHFLGGGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SPALHFLGGGSC-OH include the following: Lipid Nanoparticle Technology-Mediated Therapeutic Gene Manipulation in the Eyes T Wang, T Yu, Q Liu, TC Sung , A Higuchi - Molecular Therapy-Nucleic Acids, 2024 - cell.comhttps://www.cell.com/molecular-therapy-family/nucleic-acids/fulltext/S2162-2531(24)00123-9

Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-GEGQQHHLGGAKQAGDV-OH include the following: High-force catch bonds between the Staphylococcus aureus surface protein SdrE and complement regulator factor H drive immune evasion TO Paiva , JA Geoghegan , YF Dufracaªne - Communications Biology, 2023 - nature.comhttps://www.nature.com/articles/s42003-023-04660-1 Interaction of the Staphylococcus aureus Surface Protein FnBPB with Corneodesmosin Involves Two Distinct, Extremely Strong Bonds TO Paiva , A Viljoen , TM da Costa - ACS nanoscience , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsnanoscienceau.2c00036 Fibronectin binding protein B binds to loricrin and promotes corneocyte adhesion by Staphylococcus aureus TM da Costa , A Viljoen , AM Towell, YF Dufracaªne - Nature , 2022 - nature.comhttps://www.nature.com/articles/s41467-022-30271-1 Subdomains N2N3 of fibronectin binding protein A mediate Staphylococcus aureus biofilm formation and adherence to fibrinogen using distinct mechanisms JA Geoghegan , IR Monk , JP O'Gara - Journal of , 2013 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jb.02128-12 The Fibronectin-binding MSCRAMM FnbpA ofStaphylococcus aureus Is a Bifunctional Protein That Also Binds to Fibrinogen ER Wann, S Gurusiddappa, M Höök - Journal of biological chemistry, 2000 - ASBMBhttps://www.jbc.org/article/S0021-9258(19)80761-5/abstract Crystallization of ClfA and ClfB fragments: the fibrinogen-binding surface proteins of Staphylococcus aureus CCS Deivanayagam , S Perkins - Section D: Biological , 1999 - scripts.iucr.orghttps://scripts.iucr.org/cgi-bin/paper?GR0840 Structural basis of interfacial flexibility in fibrin oligomers A Zhmurov , AD Protopopova , RI Litvinov , P Zhukov - Structure, 2016 - cell.comhttps://www.cell.com/structure/pdf/S0969-2126(16)30242-8.pdf

Peptide H-VPLDEDFRKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VPLDEDFRKY-OH include the following: Identification of type-specific cytotoxic T lymphocyte responses to homologous viral proteins in laboratory workers accidentally infected with HIV-1. NV Sipsas , SA Kalams , A Trocha, S He - The Journal of , 1997 - Am Soc Clin Investighttps://www.jci.org/articles/view/119221 Supplemental Table 1. List of HIV class I peptides. M End - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/ed0f/0f087694817c860c5aad97fab618403c2847.pdf Cytotoxic T-lymphocyte responses to HIV-1 reverse transcriptase L Menendez-Arias , A MAS , E DOMINGO - Viral immunology, 1998 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.1998.11.167

Peptide H-VGPEILSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VGPEILSSL-OH include the following: Mass spectrometry-driven exploration reveals nuances of neoepitope-driven tumor rejection H Ebrahimi-Nik , J Michaux, WL Corwin , GLJ Keller - JCI insight, 2019 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6675551/

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of LTC4S antibody, catalog no. 70R-8802

Peptide H-VVSVLTV^LHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VVSVLTV^LHQDWLNGK^-OH include the following: Development of a chromatography-free method for high-throughput MS-based bioanalysis of therapeutic monoclonal antibodies Z Zhang, Y Yan , S Wang , N Li - Bioanalysis, 2021 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.4155/bio-2021-0021 LC-MS/MS multiplexed assay for the quantitation of a therapeutic protein BMS-986089 and the target protein Myostatin Y Zhu, C D'Arienzo, Z Lou, A Kozhich, M Madireddi - Bioanalysis, 2016 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio.15.238 LC-MS/MS determination of a human mAb drug candidate in rat serum using an isotopically labeled universal mAb internal standard W Li, H Lin, Y Fu, J Flarakos - Journal of Chromatography B, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023216315318 A robust and validated LC-MS/MS method for the quantification of ramucirumab in rat and human serum using direct enzymatic digestion without immunoassay W Huang, W Li, X Yu, M Xue, Y Yuan, C Chen - of Chromatography B, 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023223004014 Probing deamidation in therapeutic immunoglobulin gamma (IgG1) by 'bottom-up'mass spectrometry with electron transfer dissociation R Mukherjee, L Adhikary, A Khedkar - in Mass Spectrometry , 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.4464 Novel strategy using tryptic peptide immunoaffinity-based LC-MS/MS to quantify denosumab in monkey serum Q Wang, J Han, C Sha, Y Liang, Y Sun, X Shao, J Sun - Bioanalysis, 2017 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2017-0106 Development of an efficient LC-MS peptide mapping method using accelerated sample preparation for monoclonal antibodies P Jiang, F Li, J Ding - Journal of Chromatography B, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023219305793 A Streamlined Compliant Ready Workflow for Peptide-Based Multi-Attribute Method (MAM) N Ranbaduge, YQ Yu - Waters Application Note, 2020 - waters.comhttps://www.waters.com/content/dam/waters/en/app-notes/2020/720007094/720007094-zh_tw.pdf Bioanalysis of therapeutic monoclonal antibody by peptide adsorption-controlled LC-MS N Hashii, Y Tousaka, K Arai, Y Enoki, S Fukuda - Bioanalysis, 2021 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2020-0262 A universal surrogate peptide to enable LC-MS/MS bioanalysis of a diversity of human monoclonal antibody and human Fc-fusion protein drug candidates in pre MT Furlong, Z Ouyang, S Wu, J Tamura - Biomedical , 2012 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/bmc.2759 Hybrid ligand binding immunoaffinity-liquid chromatography/mass spectrometry for biotherapeutics and biomarker quantitation: how to develop a hybrid LBA M Yuan, OA Ismaiel , WRJ Mylott - Rev , 2019 - betasciencepress-publishing.comhttps://betasciencepress-publishing.com/10-17145/fulltext/rss/hybrid-ligand-binding-immunoaffinity-liquid-chromatography-mass-spectrometry-for-biotherapeutics-and-biomarker-quantitation-how-to-develop-a-hybrid-lba-lc-ms-ms-method-for-a-protein/ Isobaric duplex based on a combination of 16O/18O enzymatic exchange and labeling with pyrylium salts M Waliczek, R BÄ chor , M Kijewska, D GÄ szczyk - Analytica Chimica , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267018312145 Enhanced Pharmacokinetic Bioanalysis of Antibody-drug Conjugates using Hybrid Immunoaffinity Capture and Microflow LC-MS/MS M Suh , JB Powers, CM Daniels , Y Wu - The AAPS Journal, 2023 - Springerhttps://link.springer.com/article/10.1208/s12248-023-00835-0 SMART Digest compared to classic in-solution digestion of rituximab for in-depth peptide mapping characterization M Samonig, A Schwahn, K Cook - Thermo Scientific™, 2016 - lcms.labrulez.comhttps://lcms.labrulez.com/labrulez-bucket-strapi-h3hsga3/AN_1159_LC_SMART_Digest_Peptides_AN_72141_EN_e3222643ca/AN-1159-LC-SMART-Digest-Peptides-AN72141-EN.pdf Development of immunocapture-LC/MS assay for simultaneous ADA isotyping and semiquantitation LZ Chen, D Roos , E Philip - Journal of Immunology Research, 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2016/7682472 Reducing interferences in glycosylation site mapping L Birx, A Harvey, M Popov, R Orlando - 2022 - jbt.pubpub.orghttps://jbt.pubpub.org/pub/tpfljghx Simple and sensitive quantitation of large therapeutic proteins in plasma in 90 minutes K Meyer, UK Runcorn - lcms.czhttps://lcms.cz/labrulez-bucket-strapi-h3hsga3/an_22059_therapeutic_proteins_plasma_an22059_en_68954456da/an-22059-therapeutic-proteins-plasma-an22059-en.pdf Engineering NaV1.7 Inhibitory JzTx-V Peptides with a Potency and Basicity Profile Suitable for Antibody Conjugation To Enhance Pharmacokinetics JK Murray, B Wu, CM Tegley, TE Nixey - ACS Chemical , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acschembio.9b00183 Photo-oxidation of IgG1 and model peptides: detection and analysis of triply oxidized His and Trp side chain cleavage products J Bane, O Mozziconacci, L Yi, YJ Wang - Pharmaceutical , 2017 - Springerhttps://link.springer.com/article/10.1007/s11095-016-2058-2 Differentiation of leucine and isoleucine for enhanced sequence variant analysis using electron activated dissociation H Liu, Z Zhang - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/biopharma/MKT-30799-A_Leu_Ile_isomers_ZenoTOF7600_Final.pdf Superior characterization and monitoring of product quality attributes using an electron activated dissociation (EAD)-based multi-attribute method (MAM) H Liu, R Gomes, Z Zhang - sciex.comhttps://sciex.com/content/dam/SCIEX/tech-notes/biopharma/ruo-mkt-02-14240-a/RUO-MKT-02-14240-B_MAM%20with%20EAD%207600_B.pdf Immunocapture LC-MS methods for pharmacokinetics of large molecule drugs EG Werth, D Roos , ET Philip - Bioanalysis, 2024 - Future Sciencehttps://www.future-science.com/doi/abs/10.4155/bio-2023-0261 Absolute quantitation of binding antibodies from clinical samples C Tang, A Verwilligen, J Sadoff, B Brandenburg - npj Vaccines, 2024 - nature.comhttps://www.nature.com/articles/s41541-023-00793-w

Peptide Ac-PLGIEVDIDVEHGGKRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-PLGIEVDIDVEHGGKRC-NH2 include the following: Studies of mitophagy in mouse and fish models using antibodies and PCR KLAM Leukes - 2023 - scholar.sun.ac.zahttps://scholar.sun.ac.za/handle/10019.1/127307

A synthetic peptide for use as a blocking control in assays to test for specificity of P2ry1 antibody, catalog no. 70R-9082

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-CGGEGYGEGRGDSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CGGEGYGEGRGDSPG-OH include the following: RGD and YIGSR synthetic peptides facilitate cellular adhesion identical to that of laminin and fibronectin but alter the physiology of neonatal cardiac myocytes SY Boateng, SS Lateef, W Mosley - of Physiology-Cell , 2005 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpcell.00199.2004

Peptide H-KMALNSEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KMALNSEAL-OH include the following: The landscape of tumor fusion neoantigens: a pan-cancer analysis Z Wei, C Zhou , Z Zhang, M Guan, C Zhang, Z Liu, Q Liu - Iscience, 2019 - cell.comhttps://www.cell.com/iscience/pdf/S2589-0042(19)30407-9.pdf

IGF-I (24-41) (TFA) is a fragment of IGF-I with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.

MAL-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ANELLINVK^-OH include the following: Identification and characterization of CHO host-cell proteins in monoclonal antibody bioprocessing YH Oh , KM Mendola , LH Choe, L Min- Biotechnology and ..., 2024 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bit.28568 Characterization and implications of host-cell protein aggregates in biopharmaceutical processing YH Oh , ML Becker, KM Mendola - Biotechnology and ..., 2023 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/bit.28325 Protein turnover measurements in human serum by serial immunoaffinity LC-MS/MS V Farrokhi , X Chen, H Neubert - Clinical chemistry, 2018 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/64/2/279/5608764 i-RUBY: A novel software for quantitative analysis of highly accurate shotgun-proteomics liquid chromatography/tandem mass spectrometry data obtained without K Wada, A Ogiwara, K Nagasaka- Rapid ..., 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.4943 A database of reaction monitoring mass spectrometry assays for elucidating therapeutic response in cancer ER Remily-Wood, RZ Liu, Y Xiang- Proteomics-Clinical ..., 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201000115 Improving de novo sequencing of peptides using a charged tag and C-terminal digestion W Chen, PJ Lee, H Shion, N Ellor- Analytical chemistry, 2007 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac061670b

Neuromedin U is a neuropeptide that has been found to bind to the receptor neuromedin U receptor. It is a potent activator of ion channels and ligand for the neuromedin U receptor. Neuromedin U is also an inhibitor of angiotensin II, histamine, and serotonin release. The purified recombinant human neuromedin U protein is supplied at >98% purity with no detectable endotoxin contamination.

Peptide H-LALDNGGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LALDNGGLAR-OH include the following: Clinical assay for the early detection of colorectal cancer using mass spectrometric wheat germ agglutinin multiple reaction monitoring IJ Tsai, ECY Su, IL Tsai, CY Lin - Cancers, 2021 - mdpi.comhttps://www.mdpi.com/2072-6694/13/9/2190

Catalogue peptide; min. 95% purity

Peptide H-IIDGVPVEITEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-IIDGVPVEITEK-OH include the following: Proteomic profiling of TGFBI-null mouse corneas reveals only minor changes in matrix composition supportive of TGFBI knockdown as therapy against TGFBI ET Poulsen , K Runager, NS Nielsen - The FEBS , 2018 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1111/febs.14321

A synthetic peptide for use as a blocking control in assays to test for specificity of IL5 antibody, catalog no. 70R-6233

Peptide H-FPDENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FPDENFK^-OH include the following: Identification of differentially expressed reproductive and metabolic proteins in the female abalone (Haliotis laevigata) gonad following artificial induction of spawning O Mendoza-Porras , NA Botwright , A Reverter - and Physiology Part D , 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1744117X16300338

Histone H4 (2-21) is a pivotal core histone involved in the process of chromatinization specific to the genomes of herpes simplex virus 1 (HSV-1).

Deoxycytidine kinase (dCK, EC 2.7.1.74) is an enzyme that catalyzes the following reaction: dC + ATP → dCMP + ADP  It can also use UTP as a donor of the phosphate group, and it can phosphorylate other deoxyribonucleosides (e.g. dA, dG) as well as nucleoside analogues (like clofarabine). One unit of dCK will convert 1.0 µmole of dC and ATP to dCMP and ADP per minute at pH 7.5 and 37°C.

A synthetic peptide for use as a blocking control in assays to test for specificity of LAYN antibody, catalog no. 70R-7484

Potent, non-selective galanin receptor antagonist (Ki values are 1.82 and 5.1 nM at GAL1 and GAL2 respectively) that inhibits galanin (1-29) binding in rat

Peptide H-ALVEICTEMEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALVEICTEMEK-OH include the following: Supplemental Table 1. List of HIV class I peptides. M End - pdfs.semanticscholar.orghttps://pdfs.semanticscholar.org/ed0f/0f087694817c860c5aad97fab618403c2847.pdf

Peptide H-EAFSLFDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EAFSLFDK-OH include the following: Myosin VIIA is specifically associated with calmodulin and microtubule-associated protein-2B (MAP-2B) PT TODOROV, RE HARDISTY - Biochemical , 2001 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/354/2/267/90797 Quantitative proteomics analysis of varicose veins: identification of a set of differentially expressed proteins related to ATP generation and utilization CJ Kuo, SS Liang, E Hsi, SH Chiou , SD Lin - The Kaohsiung journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1607551X13001010 High-resolution mapping of carbene-based protein footprints CC Jumper , R Bomgarden, J Rogers - Analytical , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac300120z Regulatory sites of CaM-sensitive adenylyl cyclase AC8 revealed by cryo-EM and structural proteomics B Khanppnavar , D Schuster , P Lavriha, F Uliana - EMBO , 2024 - embopress.orghttps://www.embopress.org/doi/abs/10.1038/s44319-024-00076-y

Peptide H-SLAPYAQDTQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLAPYAQDTQEK-OH include the following: An online 2D-reversed-phase-Reversed-phase chromatographic method for sensitive and robust plasma protein quantitation VR Richard , D Domanski , AJ Percy , CH Borchers - Journal of proteomics, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391917302622

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS4 antibody, catalog no. 70R-4842

Peptide H-DR^VYIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DR^VYIHP-OH include the following: Probing sites of histidine phosphorylation with iodination and tandem mass spectrometry Q Sun , RR Julian - Rapid Communications in Mass , 2011 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.5116 A family of oligopeptide transporters is required for growth of Candida albicans on proteins O Reuss, J Morschhauser - Molecular microbiology, 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2958.2006.05136.x Ultrasonic-assisted sol-gel synthesis of core-shell silica particles for high-performance liquid chromatography L Cheng, J Cai, Y Ke - Journal of Inorganic and Organometallic Polymers , 2020 - Springerhttps://link.springer.com/article/10.1007/s10904-019-01239-4 Supramolecular Peptide-based Nanomaterials for the Treatment of Fibrosis J Liu, Q Zou - Peptide Self-Assembly and Engineering , 2024 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/9783527841264.ch20 Whey protein-derived peptide sensing by enteroendocrine cells compared with osteoblast-like cells: Role of peptide length and peptide composition, focussing on G Tulipano, L Faggi, A Cacciamali, AM Caroli - International dairy journal, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0958694617300961

Fmoc-Lys(Fmoc)-OH is an antibacterial agent that can be synthesized from a number of precursors. It has been shown to inhibit the uptake of mannose by staphylococcus cells and its subsequent use in the synthesis of bacterial cell walls. Fmoc-Lys(Fmoc)-OH also inhibits the growth of viruses, such as HIV, and human immunodeficiency virus type 1 (HIV-1), by binding to mannose receptors on the surface of macrophage-like cells. Intramolecular hydrogen bonds stabilise this complex, which prevents it from breaking down. This allows Fmoc-Lys(Fmoc)-OH to remain in the body for a longer period of time than other antibiotics that are broken down by enzymes. Fmoc-Lys(Fmoc)-OH has also been shown to be an effective antibacterial agent against Staphylococcus a

A synthetic peptide for use as a blocking control in assays to test for specificity of A4GNT antibody, catalog no. 70R-7408

Peptide H-NWVYSHDGVSLHELLAAELTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NWVYSHDGVSLHELLAAELTK-OH include the following: Quantification of human mature frataxin protein expression in nonhuman primate hearts after gene therapy T Rojsajjakul , JJ Hordeaux , GR Choudhury - Communications , 2023 - nature.comhttps://www.nature.com/articles/s42003-023-05472-z Quantification of human mature frataxin protein expression in nonhuman primate hearts after gene therapy I Blair , T Rojsajjakul , J Hordeaux , G Chaudhary - Research , 2023 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC10350221/

A synthetic peptide for use as a blocking control in assays to test for specificity of DENND1B antibody, catalog no. 70R-7093

Urocortin, human (Human urocortin I) is a 40 amino acid peptide which is closely related to corticotrophin-releasing factor (CRF).

Urantideâ„¢ is a peptide that is derived from Urotensin II and related peptides. It has been shown to be an antagonist of the urotensin receptor, which may be involved in the regulation of renal function. The peptide inhibits the release of renin, aldosterone, and vasopressin.

Custom research peptide; min purity 95%.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF285A antibody, catalog no. 70R-8124

Synthetic peptide toxin derivative of; M-lycotoxin from the Carolina wolf spider, Hogna carolinensis. This peptide can be used for transport into the cytoplasma and is available as a 0.5mg vial.

A synthetic peptide for use as a blocking control in assays to test for specificity of RHPN1 antibody, catalog no. 70R-2697

Lysozyme from chicken egg white (Lysozyme) is a bactericidal enzyme present in the chicken eggwhite, and it lyses gram-positive bacteria.

Peptide H-LEAFL^TQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LEAFL^TQK-OH include the following: Allosteric MEK inhibitors act on BRAF/MEK complexes to block MEK activation GL Gonzalez-Del Pino , K Li , E Park - Proceedings of the , 2021 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.2107207118

A synthetic peptide for use as a blocking control in assays to test for specificity of UMPS antibody, catalog no. 70R-2670

Peptide H-YQAIF^DNTTSLTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YQAIF^DNTTSLTDK-OH include the following: Targeted mass spectrometric strategy for global mapping of ubiquitination on proteins S Mollah, IE Wertz, Q Phung, D Arnott - Journal Devoted to , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.3227 SRM-MS for posttranslational modification analysis M Hossain, M Hossain - Monitoring Mass Spectrometry (SRM-MS) in , 2020 - Springerhttps://link.springer.com/chapter/10.1007/978-3-030-53433-2_8

Catalogue peptide; min. 95% purity

A synthetic peptide for use as a blocking control in assays to test for specificity of MED4 antibody, catalog no. 70R-8935

Peptide H-GVDEVAKKKSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GVDEVAKKKSK-OH include the following: Complementary methods for the identification of substrates of proteolysis VC Pham, VG Anania , QT Phung, JR Lill - Methods in Enzymology, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780124171589000145

Please enquire for more information about L-Cysteinyl-L-lysine trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Amino acids 1-44 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Amylin, amide, human(DAP Amide) is a 37-amino acid peptide hormone co-secreted with insulin to regulate postprandial glucose levels.

Lophyrotomin is a hepatotoxin isolated from the European Birch sawfly Arge pullata.

Peptide Ac-CDDINVDRENRRELVAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CDDINVDRENRRELVAK-NH2 include the following: Mutagenesis and characterization of pdpC in Francisella novicida KKM Cheung - 2007 - dspace.library.uvic.cahttp://dspace.library.uvic.ca/handle/1828/953

Peptide Ac-CLVPQHSEIPKKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CLVPQHSEIPKKA-NH2 include the following: Differential effects of peptidoglycan recognition proteins on experimental atopic and contact dermatitis mediated by Treg and Th17 cells SY Park, D Gupta , CH Kim , R Dziarski - PLoS One, 2011 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0024961