Compuestos y reactivos bioquímicos
Los bioquímicos y reactivos son sustancias fundamentales para la investigación y el desarrollo en campos como la biotecnología, la biología molecular, la farmacología y la medicina. Estos productos son esenciales para una variedad de aplicaciones, incluyendo la síntesis de compuestos, el análisis de muestras biológicas, la investigación de procesos metabólicos y la producción de medicamentos. En CymitQuimica, ofrecemos una amplia selección de bioquímicos y reactivos de alta calidad y pureza, adecuados para diversas necesidades científicas e industriales. Nuestro catálogo incluye enzimas, anticuerpos, ácidos nucleicos, aminoácidos, y muchos otros productos, todos diseñados para apoyar a los investigadores y profesionales en sus proyectos de investigación y desarrollo, asegurando resultados confiables y reproducibles.
Subcategorías de "Compuestos y reactivos bioquímicos"
- Biomoléculas
- Por objetivo biológico
- Según efectos farmacológicos
- Crioconservantes
- Desinfectantes y compuestos relacionados
- Hormonas
- Biología Vegetal
- Metabolitos secundarios
Productos de "Compuestos y reactivos bioquímicos"
Ordenar por
D-Threonine
CAS:Fórmula:C4H9NO3Pureza:(Titration) ≥ 98.0%Forma y color:White to off-white powder or crystalsPeso molecular:119.12CD49d antibody (Azide Free)
CD49d antibody was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.…H-NALARYYYDSLG-NH2
H-NALARYYYDSLG-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NALARYYYDSLG-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NALARYYYDSLG-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NALARYYYDSLG-NH2 at the technical inquiry form on this pagePureza:Min. 95%SERPINB5 antibody
SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM1-Triazene, 1-(4-methylphenyl)-3-(phenylmethyl)-
CAS:Fórmula:C14H15N3Pureza:98%Forma y color:SolidPeso molecular:225.289FCER1G antibody
FCER1G antibody was raised in rabbit using the N terminal of FCER1G as the immunogenPureza:Min. 95%Aflatoxicol
CAS:AflatoxicolFórmula:C17H14O6Pureza:By hplc: 99.6% (Typical Value in Batch COA)Forma y color: white powderPeso molecular:314.29g/molPhenol Tris Equilibrated for molecular biology w/o Stabilizer
CAS:Forma y color:Clear, Colourless, LiquidH-APNVVVTR-OH
Peptide H-APNVVVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-APNVVVTR-OH include the following: p85-RhoGDI2, a novel complex, is required for PSGL-1-induced beta1 integrin-mediated lymphocyte adhesion to VCAM-1 J Luo, T Xu, C Li, X Ba, X Wang, Y Jiang - The International Journal , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S135727251300294X scplainer: using linear models to understand mass spectrometry-based single-cell proteomics data C Vanderaa , L Gatto - bioRxiv, 2023 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2023.12.14.571792.abstractPhenytoin antibody
Phenytoin antibody was raised in mouse using phenytoin conjugated to KLH as the immunogen.Chicken anti Mouse IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Pureza:Min. 95%SPDYA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPDYA antibody, catalog no. 70R-27474-Amino-6,7-dimethoxy-1,2-dihydroquinazolin-2-one
CAS:Please enquire for more information about 4-Amino-6,7-dimethoxy-1,2-dihydroquinazolin-2-one including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C10H11N3O3Pureza:Min. 95%Peso molecular:221.21 g/molBMF
Bcl-2-modifying factor (Bmf) belongs to the BH3-only class of Bcl-2 family proteins (along with Bim). Bmf has pro-apoptotic activity and can trigger mitochondrial apoptosis via inhibition of CAP-dependent protein synthesis, it is also involved in B cell development and anoikis. Bmf activity is regulated by dynein light chain (DYNLL) 1 and 2, via inducing its homo-dimerization and leading to the formation of ternary complexes (such as Bim-DYNLL-Bmf).Peso molecular:2,441.3 g/mol
