Compuestos y reactivos bioquímicos

Influenza B Virus Nucleoprotein, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza B Virus Nucleoprotein, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

PAK2 antibody was raised in Mouse using a purified recombinant fragment of PAK2 expressed in E. coli as the immunogen.

Mouse monoclonal RABL2A antibody

Horse RBC antibody was raised in rabbit using equine erythrocytes as the immunogen.

Purified Polyclonal CDK8 antibody

2,3,4,6-Tetra-O-methyl-D-glucopyranose

H-Ser-Phe-Leu-Leu-Arg-Asn-OH is a biocompatible polymer that has been shown to have strong antioxidative properties. This polymer has been used in the development of a new class of drug for the treatment of inflammatory bowel disease, which may be due to its ability to inhibit toll-like receptor activity. H-Ser-Phe-Leu-Leu-Arg-Asn-OH also has potent immunosuppressive and antiinflammatory activities, and is stable at doses up to 200mg/kg. These properties make this polymer an attractive candidate for use as a therapeutic agent in treating bowel disease.

A synthetic peptide for use as a blocking control in assays to test for specificity of ISCA2 antibody, catalog no. 70R-2471

Orchid maintenance medium with charcoal, without agar

Mouse monoclonal SNAP25 antibody

The PAP protein is a highly versatile and important component in the field of Life Sciences. It plays a crucial role in various biological processes, including myostatin regulation, pancreatic glucagon production, and cardiac myosin function. This protein has gained significant attention due to its potential therapeutic applications. Monoclonal antibodies targeting the PAP protein have been developed for diagnostic assays and therapeutic purposes. These antibodies have shown cytotoxic effects against specific antigens, making them valuable tools for targeted therapies. Additionally, they can be used in research assays to detect and quantify the expression of PAP protein or its activated forms. Recombinant Proteins & Antigens derived from the PAP protein are widely used in scientific studies and medical research. They serve as essential tools for investigating the molecular mechanisms underlying various diseases and developing novel treatment strategies. These proteins can be utilized to study interactions with other molecules such as β-catenin or to generate autoantibodies for immunological studies. In summary,

H-GLSDYYYRALAN-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLSDYYYRALAN-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLSDYYYRALAN-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLSDYYYRALAN-NH2 at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB25 antibody, catalog no. 70R-9498

Rabbit polyclonal Collagen XVIII alpha 1 antibody

Propargyl-PEG5-NHS ester

Please enquire for more information about Affinity Purified anti-Canine Leptospira Lig A/B Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

SeramunStab® STNP HRP-conjugate stabiliser

CZ-48 is a synthetic surfactant that has been shown to have anticancer effects in vitro. In vivo, CZ-48 is metabolized and eliminated rapidly, but its low bioavailability may be overcome by the addition of a suitable stabilizer. The anticancer effect of CZ-48 is stereoselective, with an inhibitory effect on tumor growth in the lung being observed at doses of 2 mg/kg body weight. Laboratory studies have shown that CZ-48 can reduce the size of lung tumors without affecting healthy tissue. The anticancer effect of CZ-48 may be due to its ability to stabilize cancer cells and prevent them from dividing or migrating. CZ 48 is a surfactant that has been shown to have anticancer effects in vitro. In vivo, it is metabolized and eliminated rapidly, but its low bioavailability may be overcome by the addition of a suitable stabilizer. The anticancer effect of CZ 48 is stereoselect

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SVSELPIMHQDWLNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SVSELPIMHQDWLNGK-OH include the following: Analysis of deamidation artifacts induced by microwave-assisted tryptic digestion of a monoclonal antibody T Formolo, A Heckert, KW Phinney - Analytical and bioanalytical chemistry, 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-8043-x A Liquid Chromatography-Tandem Mass Spectrometry Method for Determination of Ocrelizumab in Serum of Patients with Multiple Sclerosis P Matlak, H Brozmanova, P Sistik, D Moskorova - Available at SSRN - papers.ssrn.comhttps://papers.ssrn.com/sol3/papers.cfm?abstract_id=4861160 Improving Quantification of Protein Therapeutics by Standardising the Sample Preparation Approach to LC-MS/MS Analysis: High-sensitivity Bioanalysis of EE Chambers, ME Lame - 2016 - researchgate.nethttps://www.researchgate.net/profile/Karen-Haas/publication/303483394_Improving_Quantification_of_Protein_Therapeutics_by_Standardising_the_Sample_Preparation_Approach_to_LC-MSMS_Analysis_High-sensitivity_Bioanalysis_of_Infliximab_and_Total_Antibody_Quantification_of_th/links/5744963c08ae9ace8421a432/Improving-Quantification-of-Protein-Therapeutics-by-Standardising-the-Sample-Preparation-Approach-to-LC-MS-MS-Analysis-High-sensitivity-Bioanalysis-of-Infliximab-and-Total-Antibody-Quantification-of.pdf

A synthetic peptide for use as a blocking control in assays to test for specificity of Pnrc2 antibody, catalog no. 70R-9468

CD47 antibody was raised in Rabbit using Human CD47 as the immunogen

Mouse monoclonal ANXA1 antibody

CDC801 is a peptide that binds to the extracellular domain of the CXCR4 receptor. CDC801 is an activator of the receptor, which leads to increased calcium ion influx into cells. This peptide also inhibits G protein-coupled receptors (GPCRs) by binding to their extracellular domains and blocking their ability to bind with ligands. The antibody against CDC801 may be used as a research tool in cell biology and pharmacology.

LRRC51 antibody was raised using the N terminal of LRRC51 corresponding to a region with amino acids MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSL

Mouse monoclonal PIP4K2A antibody

Please enquire for more information about Vabicaserin including the price, delivery time and more detailed product information at the technical inquiry form on this page

GPD1 antibody was raised in Rabbit using Human GPD1 as the immunogen

The SARS-CoV-2 spike protein is present on the outside of the virus particles and can bind to angiotensin-converting enzyme II (ACE2) present on the host cells. The C-terminal receptor binding domain (RBD) of the spike protein binds to the N-terminal peptidase M2 domain of ACE2. This receptor binding results in the internalisation of the virus-receptor complex and is, therefore the mechanism of entry of SARS-CoV-2 into host cells.The spike protein residues VFAQVKQIYKTPPIK (781-795) from C have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.

Please enquire for more information about Orexin A human, rat, mouse including the price, delivery time and more detailed product information at the technical inquiry form on this page

H-ADSNPRGVSAALSRPSPGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ADSNPRGVSAALSRPSPGGC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ADSNPRGVSAALSRPSPGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ADSNPRGVSAALSRPSPGGC-OH at the technical inquiry form on this page

AKAP9 antibody was raised in rabbit using the N terminal of AKAP9 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5C antibody, catalog no. 70R-2037

Rabbit polyclonal KSR antibody (Ser392)

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM149 antibody, catalog no. 70R-7261

A synthetic peptide for use as a blocking control in assays to test for specificity of NAPE-PLD antibody, catalog no. 70R-3193

PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

LDHD antibody was raised using the middle region of LDHD corresponding to a region with amino acids LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV

Applications N-Boc Gatifloxacin N-Oxide is an intermediate used in the synthesis of Gatifloxacin N-Oxide (G250005), which is an impurity of Gatifloxacin (G250000), an antibacterial agent. References Bauernfeind, A.: J. Antimicro. Chemother., 40, 639 (1997), Fukuda, H., et al.: Antimicrob. Ag. Chemother., 42, 1917 (1998),

Affinity purified Rabbit polyclonal PPP3CB antibody

2-Docosahexaenoyl-sn-glycero-3-phosphocholine is a component of cell membranes that may be important for cell signaling, regulation of ion transport, and the modulation of membrane fluidity. It has been shown to enhance the rate at which chloride ions diffuse through hydrated erythrocyte membranes. 2-Docosahexaenoyl-sn-glycero-3-phosphocholine binds to bilayers and lipids in a lamellar fashion, which may be due to its polyunsaturated fatty acid composition. The methyl group on this molecule is transferred from an S atom to a C atom in the lipid bilayer, creating an ether linkage. This process is catalyzed by esterases and glucuronidases, which hydrolyze esters or glucuronides attached at carbon 3 in 2DGPC.

TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG

Peptide H-VISPSEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VISPSEDR-OH include the following: Detection and localization of protein modifications by high resolution tandem mass spectrometry F Meng, AJ Forbes, LM Miller - Mass spectrometry , 2005 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/mas.20009

Methyl tetradecanoate is used as a component in the preparation of a high-density biodiesel. Also used as a niosome medium in which an anti-cancer drug could be transported within. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of DECR2 antibody, catalog no. 70R-1190

Mouse monoclonal Measles Virus Nucleoprotein antibody (FITC)

H-Arg-Gly-Tyr-Val-Tyr-Gln-Gly-Leu-OH is a peptide that can be used as a research tool to study protein interactions. It is also an excellent pharmacological tool for the study of ion channels, receptors, and ligands. The peptide has been shown to have antibacterial activity against Staphylococcus aureus and Escherichia coli.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Rabbit polyclonal RPL11 antibody

Cystatin C protein is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cystatin C protein including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Rabbit polyclonal HAND1 antibody

FAM29A antibody was raised using the middle region of Fam29A corresponding to a region with amino acids RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Rabbit polyclonal PKD mu antibody

Anti-Human IGF1R Monoclonal Antibody

CD4 antibody (biotin) was raised in mouse using human CD4 as the immunoge.

Please enquire for more information about Rn 9893 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal CRFR2 antibody

THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.

Rabbit polyclonal ABCB10 antibody

H-CGGLAPYSDEL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGLAPYSDEL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGLAPYSDEL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGLAPYSDEL-OH at the technical inquiry form on this page

Region of WISP1 protein corresponding to amino acids TALSPAPTTM DFTPAPLEDT SSRPQFCKWP CECPPSPPRC PLGVSLITDG CECCKMCAQQ LGDNCTEAAI CDPHRGLYCD YSGDRPRYAI GVCAQVVGVG CVLDGVRYNN GQSFQPNCKY NCTCIDGAVG CTPLCLRVRP PRLWCPHPRR VSIPGHCCEQ WVCEDDAKRP RKTAPRDTGA FDAVGEVEAW HRNCIAYTSP WSPCSTSCGL GVSTRISNVN AQCWPEQESR LCNLRPCDVD IHTLIKAGKK CLAVYQPEAS MNFTLAGCIS TRSYQPKYCG VCMDNRCCIP YKSKTIDVSF QCPDGLGFSR QVLWINACFC NLSCRNPNDI FADLESYPDF SEIAN.

Mouse monoclonal CYP2C9 antibody

Rabbit polyclonal SHCBP1 antibody

Mouse monoclonal CEA antibody

Rabbit polyclonal EKI2 antibody

HPV11 antibody was raised in mouse using papilloma virus type 11 as the immunogen.

DMEM High Glucose (4.5g/l), with L-Glutamine

Transferrin receptor antibody was raised in mouse using human soluble transferrin receptor as the immunogen.

Peptide H-LPQTLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LPQTLSR-OH include the following: A highly sensitive targeted mass spectrometric assay for quantification of AGR2 protein in human urine and serum T Shi , Y Gao , SI Quek , TL Fillmore - Journal of proteome , 2014 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr400912c Multiplexed targeted mass spectrometry assays for prostate cancer-associated urinary proteins T Shi , SI Quek , Y Gao , CD Nicora , S Nie , TL Fillmore - Oncotarget, 2017 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC5731921/

A synthetic peptide for use as a blocking control in assays to test for specificity of PWWP2A antibody, catalog no. 70R-2966

PF-05089771

Applications A cyclic nucleotides with protein kinase and phosphodiesterase activity. References Fujii, T., et al.: Chem. Pharm. Bull., 19, 1368 (1971), Montgomery, J.A., et al.: J. Med. Chem., 15, 182 (1972),

Purified Polyclonal MYBL2 antibody

Purified Polyclonal FGFR1 antibody

1-239 amino acids: MGSSHHHHHH SSGLVPRGSH MAPSVPAAEP EYPKGIRAVL LGPPGAGKGT QAPRLAENFC VCHLATGDML RAMVASGSEL GKKLKATMDA GKLVSDEMVV ELIEKNLETP LCKNGFLLDG FPRTVRQAEM LDDLMEKRKE KLDSVIEFSI PDSLLIRRIT GRLIHPKSGR SYHEEFNPPK EPMKDDITGE PLIRRSDDNE KALKIRLQAY HTQTTPLIEY YRKRGIHSAI DASQTPDVVF ASILAAFSKA TCKDLVMFI

SKP2 antibody was raised in Mouse using a purified recombinant fragment of SKP2(aa1-130) expressed in E. coli as the immunogen.

Anti PHI, humanSerum is a research tool that is used to study protein interactions. It can be used in the study of ion channels, cell biology, and pharmacology. Anti PHI, humanSerum is also an inhibitor that binds to cells and prevents them from functioning normally. This product has been shown to inhibit the activity of erythropoietin receptor (EPOR) and has been used in the inhibition of tumor growth.

HSD3B2 antibody was raised using the N terminal of HSD3B2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN

Please enquire for more information about (Lys(Z)2)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal K6PL antibody

DDX39 antibody was raised in mouse using recombinant Human Dead (Asp-Glu-Ala-Asp) Box Polypeptide 39 (Ddx39)

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Rabbit Polyclonal cJun antibody

Recombinant Mouse PGK1 protein with His tag

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC50 antibody, catalog no. 70R-2218

Catalogue peptide; min. 95% purity

TORC-2