Compuestos y reactivos bioquímicos

Peptide H-DRVYIHPFHLVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DRVYIHPFHLVI-OH include the following: Metal-catalysed oxidation of cereal prolamins for gluten-free applications X Huang - 2016 - helda.helsinki.fihttps://helda.helsinki.fi/bitstreams/2f99e863-ecbc-446a-afa5-253e8477eaf5/download The role of teratogens in neural crest development S Cerrizuela , GA Vega-Lopez - Birth Defects Research, 2020 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bdr2.1644 THE ROLE OF THE RENIN-ANGIOTENSIN SYSTEM IN PATHOGENSIS OF INTRACRANIAL. MM Shoja, PS Agutter, RS Tubbs - Journal of Recent , 2010 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=09701990&asa=Y&AN=74018359&h=wf8vUXOYSa%2FmFG9kokERjE7N9R717YJHzcTq3Moosd6JuU%2FOKNgz5j8ngUG5dSvPzEW%2BjzZMe%2BW4CTo17NH0bQ%3D%3D&crl=c

Purified native Reovirus Type 3 protein (Mouse)

(+)-LY-338979 is a pharmacological agent that binds to the receptor site of ion channels and inhibits the activity of these channels. It has been shown to inhibit the potassium channels in a variety of cells, including neurons, cardiomyocytes, and vascular smooth muscle cells. (+)-LY-338979 has also been shown to activate ligand-gated ion channels, such as nicotinic acetylcholine receptors. This drug is used as a research tool for studies on ion channel function and it may have therapeutic potential for neurological diseases such as Alzheimer's disease and Parkinson's disease. (+)-LY-338979 is also an antibody that can be used for immunohistochemical detection of proteins.

Recombinant Human Akr1b1 protein (His tag)

ALDH6A1 antibody was raised in Rabbit using Human ALDH6A1 as the immunogen

Purified recombinant RASSF3 protein (His tag)

Peptide H-HEIPVLPNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-HEIPVLPNR-OH include the following: Identification of RIP-II toxins by affinity enrichment, enzymatic digestion and LC-MS Saca
 Fredriksson, E Artursson, T Bergström - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac5032918 Multichannel open tubular enzyme reactor online coupled with mass spectrometry for detecting ricin OK Brandtzaeg , BT Roen, S Enger - Analytical , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.7b02590 Effects of ricin extracted from seeds of the castor bean (ricinuscommunis) on cytotoxicity and tumorigenesis of melanoma cells NN Trung, NT Tho , BT Thuy Dung - Research and Therapy, 2016 - Springerhttps://link.springer.com/article/10.7603/s40730-016-0023-7 Probabilistic limit of detection for ricin identification using a shotgun proteomics assay NC Heller, AM Garrett , ED Merkley - Analytical , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.9b02721 Multiplex quantification of protein toxins in human biofluids and food matrices using immunoextraction and high-resolution targeted mass spectrometry M Dupre , B Gilquin, F Fenaille - Analytical , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.analchem.5b01900 Rapid, Sensitive and Reliable Ricin Identification in Serum Samples Using LC-MS/MS. Toxins 2021, 13, 79 L Feldberg, E Elhanany, O Laskar - Characterisation of Plant , 2021 - mdpi.comhttps://www.mdpi.com/books/download_custom_book/138#page=90 Rapid, sensitive and reliable ricin identification in serum samples using LC-MS/MS L Feldberg, E Elhanany, O Laskar, O Schuster - Toxins, 2021 - mdpi.comhttps://www.mdpi.com/2072-6651/13/2/79 Optimization of digestion parameters for protein quantification J Norrgran, TL Williams, AR Woolfitt, MI Solano - Analytical , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269709003844 Mass spectrometry for the detection of bioterrorism agents: from environmental to clinical applications E Duriez, J Armengaud , F Fenaille - Journal of mass , 2016 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.3747

Purified recombinant Human CARHSP1 protein

4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine, also known as BromoBZAT, is a peptide that can be used as a research tool and an activator. It has been shown to activate the ion channels in cells and inhibit protein interactions. This product is highly pure and is sold for research purposes only.

Edaglitazone is a drug used for the treatment of type 2 diabetes. It belongs to the class of thiazolidinedione drugs, which are insulin sensitizers. Edaglitazone has shown anti-inflammatory properties and may be useful in treating inflammatory diseases such as rheumatoid arthritis. This drug can also be used as a diagnostic tool to measure insulin sensitivity in humans by measuring erythrocyte glucose uptake. Edaglitazone has been shown to inhibit tumor growth and induce apoptosis in cancer cells, but not healthy cells, in animal models.

AMY2A antibody was raised in Rabbit using Human AMY2A as the immunogen

EBV EA IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV EA IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

FMR1 antibody was raised in Rabbit using Human FMR1 as the immunogen

Factor VIII antibody (FITC) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.

Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Rabbit polyclonal VOPP1 antibody (HRP)

[D-Ala2,Met5]-Enkephalinamide is a peptide that belongs to the group of opioid peptides. It acts as an agonist and binds to the µ-opioid receptor. This receptor is involved in transmitting signals from outside the cell to inside the cell by regulating ion channels and controlling protein interactions. The binding of [D-Ala2,Met5]-Enkephalinamide to this receptor results in an inhibitory effect on neurotransmitter release, leading to a decrease of pain sensation. It has also been shown that [D-Ala2,Met5]-Enkephalinamide can act as an antagonist at other opioid receptors, such as the κ-opioid receptor.

Gemin 2 Monoclonal Antibody

Rabbit polyclonal TBX3 antibody

WNT16 antibody was raised using the C terminal of WNT16 corresponding to a region with amino acids REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG

Rabbit polyclonal PDLIM7 antibody

Applications Quinoxaline is a reagent used in the synthesis of quinoxaline diimides as small molecule non-fullerene acceptors for organic solar cells.

Mouse monoclonal UBE2E3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM90A1 antibody, catalog no. 70R-4363

N-Me-D-Glu is an amino acid that is a substrate for the enzyme glutamate dehydrogenase. It is also a substrate for the enzyme N-acetylglutamate synthase and can be converted to glutamine. This amino acid has been extensively studied in relation to its conformational properties and its ability to form covalent adducts with amines. The type species of this amino acid is Saccharomyces cerevisiae, which contains an active glutamate dehydrogenase.

Rabbit Polyclonal 4EBP1 antibody

Rabbit polyclonal ADH7 antibody

Rabbit polyclonal TROVE2 antibody

LARP1 antibody was raised in Rabbit using Human LARP1 as the immunogen

RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG

WNK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Purified Polyclonal PIGX antibody

Inhibitor of glutathione peroxidase GPX4

Rabbit polyclonal DAK antibody

Peptide H-AQLSTILEEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AQLSTILEEEK-OH include the following: ATAQS: A computational software tool for high throughput transition optimization and validation for selected reaction monitoring mass spectrometry MYK Brusniak, ST Kwok, M Christiansen - BMC , 2011 - Springerhttps://link.springer.com/article/10.1186/1471-2105-12-78 Signalling of GPI-anchored CD157 via focal adhesion kinase in MCA102 fibroblasts F Liang, CF Chang - FEBS letters, 2001 - Wiley Online Libraryhttps://febs.onlinelibrary.wiley.com/doi/abs/10.1016/S0014-5793(01)02912-X

MYL6 antibody was raised using the N terminal of MYL6 corresponding to a region with amino acids CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV

Indole-3-acetic acid methyl ester

Potential broad spectrum ?-ketoamide inhibitor of Coronavirus replication

H-YGGFMTSEK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YGGFMTSEK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YGGFMTSEK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YGGFMTSEK-OH at the technical inquiry form on this page

Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is an enzyme substrate that acts as a competitive inhibitor of the hepatitis C protease. It has been shown to inhibit the activity of the hepatitis C protease in cell culture, and can be used to identify other inhibitors of this protease. Ac-Asp-Glu-Asp(Edans)-Glu-Glu-Abu-L-Lactoyl-Ser-Lys(Dabcyl)-NH2 is a peptide with an amino acid sequence that is not found in any known proteins.

Rabbit polyclonal U1A antibody

Ac-CETESPYQELQGQ-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CETESPYQELQGQ-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CETESPYQELQGQ-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CETESPYQELQGQ-NH2 at the technical inquiry form on this page

Mouse monoclonal MGLL antibody

2-Chloro-6-phenyl-4-pyridinamine is a peptide that has been used as a research tool to study the interactions of ligands with ion channels and receptors. It is also an inhibitor of protein interactions, which can be useful for studying protein binding. This product is available in high purity and has CAS number 1354220-53-3.

Peptide H-ILLQGTPVAQMTEDAVDAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ILLQGTPVAQMTEDAVDAER-OH include the following: The minotaur proteome: Avoiding cross-species identifications deriving from bovine serum in cell culture models J Bunkenborg , GE Garcaca­a, MIP Paz, JS Andersen - , 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000103

1-97 amino acids: MSDQEAKPST EDLGDKKEGE YIKLKVIGQD SSEIHFKVKM TTHLKKLKES YCQRQGVPMN SLRFLFEGQR IADNHTPKEL GMEEEDVIEV YQEQTGG

Purified Rabbit polyclonal TK antibody

EBV VCA IgG Negative Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV VCA IgG Negative Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Peptide H-VQDSAPVETPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VQDSAPVETPR^-OH include the following: Simultaneous accurate quantification of HO-1, CD39, and CD73 in human calcified aortic valves using multiple enzyme digestion-filter aided sample pretreatment M Olkowicz, P Jablonska, J Rogowski , RT Smolenski - Talanta, 2018 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0039914018300377 Heme Oxygenase-1 targeting exosomes for temozolomide resistant glioblastoma synergistic therapy FU Rehman , Y Liu , Q Yang, H Yang, R Liu - Journal of Controlled , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365922001626

Please enquire for more information about (±)10(11)-Epdpa including the price, delivery time and more detailed product information at the technical inquiry form on this page

NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS

Estradiol Conjugate for use in immunoassays

Rabbit Polyclonal GFRA4 antibody

Purified recombinant JSRP1 protein (His tag)

Influenza B antibody (FITC) was raised in mouse using am Infuenze B nuclear protein as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP3 antibody, catalog no. 70R-7455

N-Omega-allyl-L-arginine is a synthetic peptide with inhibitory activity against protein interactions. It has been used as a research tool to study the activation of ion channels, receptor binding, and ligand binding. N-Omega-allyl-L-arginine is also an activator of the nitric oxide synthase enzyme. This product is a high purity, pharmaceutical grade product that can be used in life science research applications, including antibody production and cell biology.

Please enquire for more information about Immunoglobulin G, Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-LGLLLHDSIQIPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LGLLLHDSIQIPR-OH include the following: Dystrophin protein quantification as a Duchenne muscular dystrophy diagnostic biomarker in dried blood spots using multiple reaction monitoring tandem mass RM Nimer , KM Sumaily, A Almuslat, MA Jabar, EM Sabi - Molecules, 2022 - mdpi.comhttps://www.mdpi.com/1420-3049/27/12/3662

KLHL5 antibody was raised in rabbit using the N terminal of KLHL5 as the immunogen

Rabbit polyclonal PFN1 antibody (biotin)

Peptide H-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH include the following: Rapid synthesis of magnetic polyimine nanospheres at room temperature for enrichment of endogenous C-peptide Z Li, H Zhang, Y Zhu, B Luo, J He, F Lan - Colloid and Interface , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2215038221000303 Development of SI-traceable C-peptide certified reference material NMIJ CRM 6901-a using isotope-dilution mass spectrometry-based amino acid analyses T Kinumi, M Goto, S Eyama, M Kato, T Kasama - Analytical and , 2012 - Springerhttps://link.springer.com/article/10.1007/s00216-012-6097-1 Quantifying the Binding Interactions Between Cu (II) and Peptide Residues in the Presence and Absence of Chromophores S Choi, JA San Juan, MC Heffern - JoVE (Journal of , 2022 - jove.comhttps://www.jove.com/t/63668/quantifying-binding-interactions-between-cu-ii-peptide-residues Novel formulations of C-peptide with long-acting therapeutic potential for treatment of diabetic complications N Zashikhina, V Sharoyko, M Antipchik, I Tarasenko - Pharmaceutics, 2019 - mdpi.comhttps://www.mdpi.com/1999-4923/11/1/27 Peptide-Peptide Co-Assembly: A Design Strategy for Functional Detection of C-peptide, A Biomarker of Diabetic Neuropathy KH Chan , J Lim, JE Jee, JH Aw, SS Lee - International Journal of , 2020 - mdpi.comhttps://www.mdpi.com/1422-0067/21/24/9671 Induced pluripotent stem cell macrophages present antigen to proinsulin-specific T cell receptors from donor-matched islet-infiltrating T cells in type 1 diabetes K Joshi , C Elso, A Motazedian , T Labonne - Diabetologia, 2019 - Springerhttps://link.springer.com/article/10.1007/s00125-019-04988-6

A synthetic peptide for use as a blocking control in assays to test for specificity of MARVELD3 antibody, catalog no. 70R-6394

Rabbit polyclonal RBL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF138 antibody, catalog no. 70R-8721

β-D-Glucopyranose 1-phosphate disodium salt

Purified Polyclonal STK17B antibody

Rabbit polyclonal p53 antibody

Mouse monoclonal SulT1A1 antibody

Mouse monoclonal CRYAB antibody

Mouse monoclonal TMEFF2 antibody

NY-ESO-1 (157-165) C165V - SLLMWITQV - General analogue epitope of tumor cells HLA-A*02 Major Histocompatibility Complex (MHC) allele HLA-A*02 allele is expressed in class I Human MHC Leukocyte Antigens (HLA), that are cell surface receptors, presenting peptides to the immune system. If a non-self-peptide is recognized by cytotoxic T-cells in the blood, cell death will be initiated via apoptosis. NY-ESO-1 protein Peptides presented by MHC class I molecule, are usually between 7 and 11 amino acids, originating from proteins expressed by the cell. SLLMWITQV peptide differes from the New York esophageal squamous cell carcinoma 1 (NY-ESO-1 : UniProt - P78358) native SLLMWITQC peptide, whose protein is part of a well-characterized group of cancer/testis antigens (CTAs). Normally, NY-ESO-1 expression is restricted to germ cells and placental cells. However it is also expressed in 82% of neuroblastomas and 46% of melanomas, as well as in many other solid tumors and hematological malignancies. NY-ESO-1 (157-165) C165V peptide application Class I HLA molecules of the cancerous cells cited above present peptides from NY-ESO-1 protein, including SLLMWITQC, that binds the binding cleft of the HLA-A*0201 complex. NY-ESO-1 being the most immunogenic among the CTA family members, its peptides constitute attractive targets for specific immunotherapies and the stimulation of human NY-ESO-1 specific CD8+ T cells. In order to better stimulate specific cytotoxic T-cells in PBMCs and analyze by ELISPOT peptide epitope, specificity, and cytokine production, like IFN-γ, SLLMWITQV variant peptide was used, as it is known to have a higher affinity for the binding cleft of the HLA-A*0201 complex than the native peptide. Moreover, SLLMWITQV has been used with adjuvant in protein nanoparticles in order to study cell-mediated immune responses and is also used in clinical trial to study the immunological effects of vaccines containing NY-ESO-1 (157-165) C165V. SB-PEPTIDE also offers NY-ESO-1 (157-165) native peptide, as well as NY-ESO-1 (157-165) C165V biotinylated and scrambled versions.

Peptide H-VYDFFVWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYDFFVWL-OH include the following: Innovative DNA vaccine to break immune tolerance against tumor self-antigen TH Kang, CP Mao, V La, A Chen, CF Hung - Human gene , 2013 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/hum.2012.141 SING: a novel strategy for identifying tumor-specific, cytotoxic T lymphocyte-recognized tumor antigens T Zhang , X He, T C. Tsang, D T. Harris - The FASEB journal, 2004 - Wiley Online Libraryhttps://faseb.onlinelibrary.wiley.com/doi/abs/10.1096/fj.03-0881fje Augmented induction of CD8+ cytotoxic T-cell response and antitumour resistance by T helper type 1-inducing peptide T Kikuchi, S Uehara, H Ariga, T Tokunaga - , 2006 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2567.2005.02262.x Enhancement of antitumor immunity by prolonging antigen presentation on dendritic cells RF Wang, HY Wang - Nature biotechnology, 2002 - nature.comhttps://www.nature.com/articles/nbt0202-149 TAP expression reduces IL-10 expressing tumor infiltrating lymphocytes and restores immunosurveillance against melanoma QJ Zhang, RP Seipp, SS Chen - journal of cancer, 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.22371 Percutaneous peptide immunization via corneum barrier-disrupted murine skin for experimental tumor immunoprophylaxis N Seo , Y Tokura , T Nishijima - Proceedings of the , 2000 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.97.1.371 Dendritic cells break tolerance and induce protective immunity against a melanocyte differentiation antigen in an autologous melanoma model MWJ Schreurs, AAO Eggert, AJ de Boer, JLM Vissers - Cancer Research, 2000 - AACRhttps://aacrjournals.org/cancerres/article-abstract/60/24/6995/506996 Identification of tyrosinase-related protein 2 as a tumor rejection antigen for the B16 melanoma MB Bloom , D Perry-Lalley, PF Robbins, Y Li - The Journal of , 1997 - rupress.orghttps://rupress.org/jem/article-abstract/185/3/453/7069 epitopes fused to an endoplasmic reticulum translocation signal sequence affords protection against tumors with down-regulated expression of MHC and peptide M Sherritt, L Cooper, DJ Moss, N Kienzle - International , 2001 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/13/3/265/993204 Identification of HLA-A24-restricted epitopes with high affinities to Hsp70 using peptide arrays M Okochi, H Hayashi, A Ito , R Kato , Y Tamura - Journal of bioscience , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1389172308700525 Effective cooperation of monoclonal antibody and peptide vaccine for the treatment of mouse melanoma LV Ly, M Sluijter, SH van der Burg - The Journal of , 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/190/1/489/86499 Silencing of SOCS1 enhances antigen presentation by dendritic cells and antigen-specific anti-tumor immunity L Shen, K Evel-Kabler, R Strube, SY Chen - Nature biotechnology, 2004 - nature.comhttps://www.nature.com/articles/nbt1035 Cancer vaccine design: a novel bacterial adjuvant for peptide-specific CTL induction I Miconnet, I Coste, F Beermann, JF Haeuw - The Journal of , 2001 - journals.aai.orghttps://journals.aai.org/jimmunol/article/166/7/4612/74842 Vaccination with Poly-l-Arginine As Immunostimulant for Peptide Vaccines: Induction of Potent and Long-Lasting T-Cell Responses against Cancer Antigens F Mattner, JK Fleitmann, K Lingnau, W Schmidt - Cancer research, 2002 - AACRhttps://aacrjournals.org/cancerres/article-abstract/62/5/1477/509671 Murine CD8 T-cell functional avidity is stable in vivo but not in vitro: independence from homologous prime/boost time interval and antigen density CB Gilfillan, C Wang , MO Mohsen - European journal of , 2020 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201948355 Efficient nonviral transfection of dendritic cells and their use for in vivo immunization AS Irvine, PKE Trinder, DL Laughton - Nature , 2000 - nature.comhttps://www.nature.com/articles/nbt1200_1273 Specific peptide-mediated immunity against established melanoma tumors with dendritic cells requires IL-2 and fetal calf serum-free cell culture AO Eggert, JC Becker , M Ammon - European journal of , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/1521-4141(200201)32:1%3C122::AID-IMMU122%3E3.0.CO;2-C Biodistribution and vaccine efficiency of murine dendritic cells are dependent on the route of administration AAO Eggert, MWJ Schreurs, OC Boerman, WJC Oyen - Cancer research, 1999 - AACRhttps://aacrjournals.org/cancerres/article-abstract/59/14/3340/505289 Dendritic cells require STAT-1 phosphorylated at its transactivating domain for the induction of peptide-specific CTL A Pilz, W Kratky, S Stockinger, O Simma - The Journal of , 2009 - journals.aai.orghttps://journals.aai.org/jimmunol/article/183/4/2286/83768

Rat sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

FGF basic antibody (biotin) was raised in rabbit using highly pure recombinant human FGF-basic as the immunogen.

1(S),9(R)-(-)-Bicuculline methbromide is a potent inhibitor of protein kinases that has been shown to induce apoptosis in cancer cells. It is derived from the urine of Chinese strain rats and inhibits the activity of D-xylose kinase, which is involved in the metabolism of xylose. 1(S),9(R)-(-)-Bicuculline methbromide has been studied extensively for its anti-cancer properties and has shown promising results in tumor cell lines. It induces apoptosis in human cancer cells by inhibiting the activity of specific kinases that are essential for cell survival. This compound may be a potential candidate for cancer therapy due to its ability to selectively target cancer cells while sparing normal cells.

SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF

Anti-Human IL-6R Monoclonal Antibody

H-ICSDATVKTGTVEEM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ICSDATVKTGTVEEM-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ICSDATVKTGTVEEM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ICSDATVKTGTVEEM-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of DYSF antibody, catalog no. 70R-6700

Mouse monoclonal CKMB antibody (MM subunit)

ApoE2 is a recombinant human protein that is capable of binding to the low-density lipoprotein receptor and inducing receptor activity. ApoE2 has been shown to induce tumor cell death in vitro, which may be due to its ability to activate apoptosis pathways. ApoE2 also induces the proliferation of basic fibroblasts, suggesting that it may have physiological effects on tissues other than cancer cells. ApoE2 is a disulfide-bonded homodimer, which has led some researchers to hypothesize that this structure plays an important role in its biological properties.

Rabbit polyclonal KLHL3 antibody

Purified Polyclonal Ezrin antibody

Purified Polyclonal MPP9 antibody

CALML5 antibody was raised in Rabbit using Human CALML5 as the immunogen