Compuestos y reactivos bioquímicos

FBN1 antibody was raised in rabbit using the N terminal of FBN1 as the immunogen

Custom research peptide; min purity 95%.

Catalogue peptide; min. 95% purity

Purified recombinant Human HAGH protein

Methyl 6,6',6''-trideoxy-6,6',6''-triiodo-?-D-cellohexaoside

CKMB antibody (B subunit) was raised in mouse using purified human CK-MB as the immunogen.

AZD-0284 is a small molecule that inhibits the transcriptional activity of nuclear receptors. It has shown efficacy in animal models of autoimmune disease and is currently being studied in human clinical trials for treatment of psoriasis. AZD-0284 binds to the ligand binding region at the N-terminus of nuclear receptor DNA-binding domain, preventing it from binding to DNA and initiating transcription. The compound has been shown to inhibit interleukin (IL)-17 production in an IL-17 knockout mouse model. Effects on IL-17 levels were associated with decreased severity of inflammatory skin diseases such as atopic dermatitis, psoriasis, and allergic contact dermatitis.

Serotonin receptor antagonist

H-KIGPENPYNTPVFAI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KIGPENPYNTPVFAI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KIGPENPYNTPVFAI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KIGPENPYNTPVFAI-OH at the technical inquiry form on this page

H-WLRGEPSHENNRQEDCVV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WLRGEPSHENNRQEDCVV-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WLRGEPSHENNRQEDCVV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WLRGEPSHENNRQEDCVV-OH at the technical inquiry form on this page

Bromo-PEG3-t-butyl ester

Goat anti Human IgM antibody

CD44 binding peptide derived from residues 136-143 of the connecting peptide domain of human urokinase plasminogen activator (uPA). Modulates CD44-mediated cell signalling but does not bind to the uPA receptor or interfere with the uPA/uPAR interaction.  Inhibits migration, invasion, and metastasis of tumour cells in animal models.

Biotinylated aMp3 is a Mycobacterium avium subsp. Paratuberculosis (MAP) specific ligand. MAP can cause Johne disease (the wasting disease) in livestock. It is important therefore to detect the presence of MAP in animal milk and faeces.Biotinylated aMp3 can be used (along with aMptD peptides) to detect the viability of MAP cells in infected livestock through combined peptide-mediated magnetic separation phage display due to their high affinity for MAP. The addition of biotin to aMp3 asparagine residue, changes the orientation of aMp3 so that it can bind to the target bacteria with increased stability, thus achieving a high capture efficiency. A similar effect is observed on the addition of biotin to aMptD glycine residue.

BD3 antibody was raised in rabbit using residues 23-33 [GIINTLQKYYC] of the 5-kDa human beta-defensin-3 protein as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of DUX5 antibody, catalog no. 20R-1209

Oxazepam Conjugate for use in immunoassays

3-[N,N-Bis(hydroxyethyl)amino]-2-hydroxypropanesulphonic acid

m-PEG48-amine

Rabbit polyclonal RAD23A antibody (biotin)

Diprovocim-1 is an immunological adjuvant, which is a synthetic compound designed to enhance the body's immune response to an antigen. This compound is crafted through chemical synthesis, representing a class of molecules that actively engage the immune system's receptors to boost the efficacy of vaccines. Diprovocim-1 functions by stimulating Toll-like receptors on immune cells, thereby enhancing the activation and proliferation of antigen-presenting cells. This mode of action is critical for augmenting the body’s adaptive immune response, leading to a more robust and sustained immunity. The primary applications of Diprovocim-1 lie in vaccine development, where it serves as a critical component in formulating vaccines with heightened immunogenicity. It is particularly valuable in scenarios where traditional vaccines may elicit a suboptimal immune response. By incorporating Diprovocim-1, researchers can potentially reduce the required antigen dose while achieving superior protective outcomes. Its role in enhancing immune memory makes it an appealing choice for emerging infectious diseases and challenging pathogens. Through its targeted mode of action, Diprovocim-1 represents a promising tool in the advancement of next-generation vaccines.

Rabbit polyclonal GADD45GIP1 antibody

GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD

A synthetic peptide for use as a blocking control in assays to test for specificity of RAE1 antibody, catalog no. 70R-4676

IFFO1 antibody was raised in Rabbit using Human IFFO1 as the immunogen

MTA2 antibody was raised in Rabbit using Human MTA2 as the immunogen

m-PEG48-Mal

A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;

Purified Polyclonal KCNAB3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf92 antibody, catalog no. 70R-3711

Rat monoclonal CD24 antibody (PE)

Peptide Ac-LRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-LRLRGG-CHO include the following: ISG15 and immune diseases YJ Jeon, HM Yoo , CH Chung - et Biophysica Acta (BBAhttps://www.sciencedirect.com/science/article/pii/S0925443910000487 Chemical methods for protein site-specific ubiquitination W Gui , GA Davidson , Z Zhuang - RSC Chemical Biology, 2021 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2021/cb/d0cb00215a Allosteric mechanism for site-specific ubiquitination of FANCD2 VK Chaugule , C Arkinson , ML Rennie - Nature chemical , 2020 - nature.comhttps://www.nature.com/articles/s41589-019-0426-z IFN-stimulated gene 15 is an alarmin that boosts the CTL response via an innate, NK cell-dependent route V Iglesias-Guimarais, T Ahrends , E de Vries - The Journal of , 2020 - journals.aai.orghttps://journals.aai.org/jimmunol/article/204/8/2110/1247 Structural basis for the removal of ubiquitin and interferon-stimulated gene 15 by a viral ovarian tumor domain-containing protease TW James, N Frias-Staheli, JP Bacik - Proceedings of the , 2011 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.1013388108 ISG15 deficiency and increased viral resistance in humans but not mice SD Speer, Z Li, S Buta, B Payelle-Brogard - Nature , 2016 - nature.comhttps://www.nature.com/articles/ncomms11496 Nature-inspired protein ligation and its applications R Pihl , Q Zheng , Y David - Nature Reviews Chemistry, 2023 - nature.comhttps://www.nature.com/articles/s41570-023-00468-z Gene cloning and expression analysis of ubiquitin derived from Musca domestica Q Ren, W Zhang, XF Zhao - Archives of Insect , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/arch.20251 Substrate properties of ubiquitin carboxyl-terminally derived peptide probes for protein ubiquitination MM Madden, W Song , PG Martell, Y Ren, J Feng - Biochemistry, 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi702078m Supplementary Figure S1 MKDQ QRLIFAGKQL, EI LRLRGG - researchgate.nethttps://www.researchgate.net/profile/Elisabeth-Elder/publication/294068162_Supplementary_Figure_1/links/56ea8bb508ae3a5b48ce501e/Supplementary-Figure-1.pdf Discovery of small molecule antagonists of the USP5 zinc finger ubiquitin-binding domain MK Mann, I Franzoni, RF de Freitas - Journal of medicinal , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jmedchem.9b00988 Post-Assembly Modification of Protein Cages by Ubc9-Mediated Lysine Acylation MD Levasseur , R Hofmann, TGW Edwardson - , 2022 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.202200332 Ubiquitin-like polypeptide conjugates to acceptor proteins in concanavalin A-and interferon γ-stimulated T-cells M NAKAMURA, Y TANIGAWA - Biochemical Journal, 1998 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/330/2/683/35540 Decorating proteins with LACE M Fottner , K Lang - Nature Chemistry, 2020 - nature.comhttps://www.nature.com/articles/s41557-020-00566-1 Functional conservation and divergence of the helix-turn-helix motif of E2 ubiquitin-conjugating enzymes KA Welsh, DL Bolhuis, AE Nederstigt, J Boyer - The EMBO , 2022 - embopress.orghttps://www.embopress.org/doi/abs/10.15252/embj.2021108823 Molecular cloning and expression analysis of an interferon stimulated gene 15 from rock bream Oplegnathus fasciatus JW Kim, MG Kwon, M Park, JY Hwang, HJ Park - Journal of fish , 2010 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=b67531b0a993627f0cefa82f19850c8cebc27503 Functional analysis of the C terminal ubiquitin-like motif of Apoptosis Signal-Regulating Kinase 1 JR Schneider - 2012 - search.proquest.comhttps://search.proquest.com/openview/c934de2851a80c2ebc4c2637e9b2778f/1?pq-origsite=gscholar&cbl=18750 Purification and antimicrobial function of ubiquitin isolated from the gill of Pacific oyster, Crassostrea gigas JK Seo, MJ Lee, HJ Go, G Do Kim, H Do Jeong - Molecular , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589012003495 Interferon-stimulated gene 15 (ISG15) and ISG15-linked proteins can associate with members of the selective autophagic process, histone deacetylase 6 (HDAC6) H Nakashima, T Nguyen, WF Goins - Journal of Biological , 2015 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)57808-3/abstract Ubiquitin-like sequence in ASK1 plays critical roles in the recognition and stabilization by USP9X and oxidative stress-induced cell death H Nagai, T Noguchi , K Homma, K Katagiri, K Takeda - Molecular cell, 2009 - cell.comhttps://www.cell.com/molecular-cell/pdf/S1097-2765(09)00781-3.pdf Identification and expression analysis of an interferon stimulated gene 15 (ISG15) from black rockfish, Sebastes schlegeli GW Baeck, JW Kim, CI Park - Fish & Shellfish Immunology, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1050464808001897 Cloning and expression analysis of a ubiquitin gene (Ub L40 ) in the haemocytes of Crassostrea hongkongensis under bacterial D Fu, Y Zhang, Z Yu - Chinese Journal of Oceanology and Limnology, 2011 - Springerhttps://link.springer.com/article/10.1007/s00343-011-9090-1 Zebrafish ISG15 exerts a strong antiviral activity against RNA and DNA viruses and regulates the interferon response C Langevin , LM Van der Aa, A Houel, C Torhy - Journal of , 2013 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01294-12 Specificity of the E1-E2-E3 enzymatic cascade for ubiquitin C-terminal sequences identified by phage display B Zhao, K Bhuripanyo, J Schneider , K Zhang - ACS chemical , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/cb300339p SUMO-mimicking peptides inhibiting protein SUMOylation B Zhao, EB Villhauer, K Bhuripanyo - , 2014 - Wiley Online Libraryhttps://chemistry-europe.onlinelibrary.wiley.com/doi/abs/10.1002/cbic.201402472 Inhibiting the protein ubiquitination cascade by ubiquitin-mimicking short peptides B Zhao, CHJ Choi, K Bhuripanyo, EB Villhauer - Organic , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ol3027736 ISG15-dependent Regulation AL Haas - Protein Degradation Series: 4 Volume Set, 2007 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/9783527619320.ch5b One-Step sortase-mediated chemoenzymatic semisynthesis of deubiquitinase-resistant ub-peptide conjugates AK Singh , S Murmu , A Krezel - ACS omega, 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsomega.2c05652 Divergence in ubiquitin interaction and catalysis among the ubiquitin-specific protease family deubiquitinating enzymes AH Tencer, Q Liang, Z Zhuang - Biochemistry, 2016 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.biochem.6b00033 Enzymatic bioconjugation: a perspective from the pharmaceutical industry A Debon , E Siirola , R Snajdrova - JACS Au, 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacsau.2c00617

Purified Polyclonal Cytochrome P450 27A1 antibody

N-(2-Hydroxyethyl)piperazine-N'-2-hydroxypropanesulphonic acid

Purified recombinant Hepatitis C Virus protein

Region of PEDF protein corresponding to amino acids MQNPASPPEE GSPDPDSTGA LVEEEDPFFK VPVNKLAAAV SNFGYDLYRV RSSMSPTTNV LLSPLSVATA LSALSLGAEQ RTESIIHRAL YYDLISSPDI HGTYKELLDT VTAPQKNLKS ASRIVFEKKL RIKSSFVAPL EKSYGTRPRV LTGNPRLDLQ EINNWVQAQM KGKLARSTKE IPDEISILLL GVAHFKGQWV TKFDSRKTSL EDFYLDEERT VRVPMMSDPK AVLRYGLDSD LSCKIAQLPL TGSMSIIFFL PLKVTQNLTL IEESLTSEFI HDIDRELKTV QAVLTVPKLK LSYEGEVTKS LQEMKLQSLF DSPDFSKITG KPIKLTQVEH RAGFEWNEDG AGTTPSPGLQ PAHLTFPLDY HLNQPFIFVL RDTDTGALLF IGKILDPRGP

Cortisol is a steroid hormone that plays a crucial role in various physiological processes. It is involved in the regulation of metabolism, immune response, and stress response. Cortisol is commonly used as a biomarker for assessing stress levels and adrenal function. In the field of Life Sciences, cortisol is widely studied and utilized for its diverse applications. Researchers often use specific antibodies and monoclonal antibodies to measure cortisol concentration in biological samples. These antibodies can be used in various techniques such as enzyme-linked immunosorbent assay (ELISA) or immunoassays. Electrodes are also employed to detect cortisol levels. These electrodes are designed to selectively bind to cortisol molecules, allowing for accurate measurement of its concentration. Furthermore, cortisol has been found to interact with epidermal growth factor (EGF). This interaction may have implications in cell growth and differentiation processes. Synthetic analogs of cortisol have been developed as potential therapeutic agents targeting EGF pathways. In addition, inhibitors of cortisol synthesis or action have

Please enquire for more information about 8-Methoxy entecavir including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal PRKD2 antibody

Peptide H-DGVPVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DGVPVIK-OH include the following: Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts T Stasyk , J Holzmann, S Stumberger, HL Ebner - , 2010 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.201000258 Stoichiometry Determination of the MP1-p14 Complex Using a Novel and Cost-Efficient Method To Produce an Equimolar Mixture of Standard Peptides J Holzmann, P Pichler, M Madalinski - Analytical , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac902286m

Bis-PEG6-acid

β-D-Galactopyranosyl azide

?-D-Cellobiosyl fluoride heptaacetate

Purified recombinant Human IL21 protein

3,4,6-Tri-O-acetyl-2-deoxy-2-phthalimido-?-D-glucopyranose

Mouse Monoclonal LDHB antibody

Peptide H-GGLPLEEVTVAEVLAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GGLPLEEVTVAEVLAAR-OH include the following: Single Systemic Administration of a Gene Therapy Leading to Disease Treatment in Metachromatic Leukodystrophy Arsa Knock-Out Mice TS Martin, TA Seabrook, K Gall, J Newman - Journal of , 2023 - Soc Neurosciencehttps://www.jneurosci.org/content/43/19/3567.abstract

Peptide H-DISEMFLQIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DISEMFLQIYK^-OH include the following: Targeted proteomics of plasma extracellular vesicles uncovers MUC1 as combinatorial biomarker for the early detection of high-grade serous ovarian cancer TT Cooper , DZ Dieters-Castator , J Liu- Journal of Ovarian ..., 2024 - Springerhttps://link.springer.com/article/10.1186/s13048-024-01471-8 Comprehensive proteomic analysis of human endometrial fluid aspirate J Casado-Vela , E Rodriguez-Suarez- Journal of proteome ..., 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr9004426

A synthetic peptide for use as a blocking control in assays to test for specificity of Shkbp1 antibody, catalog no. 70R-8074

Purified Rabbit polyclonal TUBGCP6 antibody

Mouse monoclonal CAT antibody

Affinity purified Rabbit polyclonal Cullin 3 antibody

H-CGGPSQGRSP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGPSQGRSP-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGPSQGRSP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGPSQGRSP-OH at the technical inquiry form on this page

HtrA2/Omi antibody was raised in mouse using recombinant human HtrA2/Omi (134-458aa) purified from E. Coli as the immunogen.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of Prkch antibody, catalog no. 70R-9429

H-NGDYSEVALNVTESF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NGDYSEVALNVTESF-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NGDYSEVALNVTESF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NGDYSEVALNVTESF-OH at the technical inquiry form on this page

Rabbit polyclonal KCND2 antibody (Ser616)

Guinea pig polyclonal Prealbumin antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of Hspbp1 antibody, catalog no. 70R-9291

U 89843a is a GABA receptor modulator that is used as an adjunct therapy for the treatment of epilepsy. It has been shown to increase the number of GABA receptors in the brain and reduce seizures in animal models. U 89843a is also used to study the physiology and function of gamma-aminobutyric acid (GABA) receptors, which are found in most parts of the body including the central nervous system. The drug activates GABA receptors by binding to its subunit, which results in a decrease in neuronal excitability and an increase in inhibitory neurotransmission. This agent has also been shown to have a specific effect on acid-sensitive GABAA receptor sites and may be useful for treating conditions such as peptic ulcers and gastroesophageal reflux disease.

KLK1

Peptide H-FLSKQYMDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Rabbit Polyclonal p44/42 MAP Kinase antibody (Thr202)

A synthetic peptide for use as a blocking control in assays to test for specificity of DDB2 antibody, catalog no. 70R-10002

Purified Polyclonal PPP2R5A antibody

Peptide H-LRPVAAEVYGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LRPVAAEVYGTER^-OH include the following: Serine protease PrtA from Streptococcus pneumoniae plays a role in the killing of S. pneumoniae by apolactoferrin S Mirza , L Wilson, WH Benjamin Jr, J Novak - Infection and , 2011 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.00489-10

Rabbit Polyclonal cCbl antibody (Tyr700)

SARS-CoV-2 Spike RBD 336-347 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). SARS-CoV-2 Spike RBD 336-347 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry. SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 336-347 (Biotin-LC) peptide

Please enquire for more information about HWL-088 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal TPMT antibody

Rat monoclonal IgG2b Isotype Control Fc fusion protein (allophycocyanin)

Goat polyclonal Human Ferritin antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP8B1 antibody, catalog no. 70R-9994

Mouse monoclonal CD24 antibody (biotin)

ITI-214 is a new drug that has been shown to have a number of potential therapeutic uses. It has been shown to inhibit locomotor activity, which may be due to its ability to inhibit the release of calcium from the sarcoplasmic reticulum. ITI-214 also inhibits cyclic nucleotide phosphodiesterases, which are enzymes that break down cyclic nucleotides and thereby regulate cellular function. This inhibition leads to an increase in intracellular levels of cAMP, leading to enhanced physiological function. ITI-214 has been shown to have anti-cancer effects in vitro and in vivo. It also enhances the efficacy of cancer treatments such as radiation therapy and chemotherapy, by inhibiting tumor growth and enhancing immune responses against cancer cells. The mechanism by which ITI-214 exerts these effects is not yet known but may be related to its ability to inhibit Ercc1, a gene associated with hereditary colon cancer susceptibility or other genes involved in DNA repair pathways.

Purified Rabbit polyclonal BNIP2 antibody

Peptide LCBiot-VTSAPDTRPAPGSTAPPAHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using LCBiot-VTSAPDTRPAPGSTAPPAHG-OH include the following: Synthesis and antibody recognition of synthetic antigens from MUC1 Z Banoczi , G Mezacaµ , E Windberg, K Uray - Journal of Peptide , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.950 Multivalent Protein Glycosylation: A Driving Force of Cancer Progression and Alzheimer's Disease Pathogenesis YN Singh - 2022 - search.proquest.comhttps://search.proquest.com/openview/44e075c36857a18b169b150d902e774c/1?pq-origsite=gscholar&cbl=18750&diss=y Structurally defined synthetic cancer vaccines: analysis of structure, glycosylation and recognition of cancer associated mucin, MUC-1 derived peptides X Liu, J Sejbal, G Kotovych, RR Koganty - Glycoconjugate , 1995 - Springerhttps://link.springer.com/article/10.1007/BF00731254 Random glycopeptide bead libraries for seromic biomarker discovery SK Kracun , E Clo, H Clausen , SB Levery - Journal of proteome , 2010 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr1008477 Expression of MUC1 and its significance in hepatocellular and cholangiocarcinoma tissue SF Yuan, KZ Li, L Wang, KF Dou, Z Yan - World Journal of , 2005 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4615407/ Retargeting of human T cells to tumor-associated MUC1: the evolution of a chimeric antigen receptor S Wilkie, G Picco, J Foster, DM Davies - The Journal of , 2008 - journals.aai.orghttps://journals.aai.org/jimmunol/article/180/7/4901/38447 Epitope characterization of MUC1 antibodies S Imai, S Haga, Y Kiyozuka - Tumor Biology, 1998 - karger.comhttps://karger.com/tbi/article-pdf/19/Suppl.%201/30/3566252/000056502.pdf Specificity analysis of sera from breast cancer patients vaccinated with MUC1-KLH plus QS-21 S Adluri, T Gilewski, S Zhang, V Ramnath - British journal of , 1999 - nature.comhttps://www.nature.com/articles/6690288 Stable one-step technetium-99m labeling of His-tagged recombinant proteins with a novel Tc (I)-carbonyl complex R Waibel, R Alberto , J Willuda, R Finnern - Nature , 1999 - nature.comhttps://www.nature.com/articles/nbt0999_897 Target-specific cytotoxic activity of recombinant immunotoxin scFv (MUC1)-ETA on breast carcinoma cells and primary breast tumors R Singh, U Samant, S Hyland, PR Chaudhari - Molecular Cancer , 2007 - AACRhttps://aacrjournals.org/mct/article-abstract/6/2/562/236298 Multiplexed detection of autoantibodies to glycopeptides using microarray JW Pedersen, A Nostdal, HH Wandall - Immunoproteomics: Methods and , 2019 - Springerhttps://link.springer.com/protocol/10.1007/978-1-4939-9597-4_12 Structural and dynamic consequences of increasing repeats in a MUC1 peptide tumor antigen JT Schuman, JS Grinstead - Biopolymers , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.20190 Epitope mapping of antigenic MUC1 peptides to breast cancer antibody fragment B27. 29: a heteronuclear NMR study JS Grinstead, JT Schuman, AP Campbell - Biochemistry, 2003 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi0301237 Biologics through chemistry: total synthesis of a proposed dual-acting vaccine targeting ovarian cancer by orchestration of oligosaccharide and polypeptide domains J Zhu, Q Wan, G Ragupathi, CM George - Journal of the , 2009 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja810147j Correlation of MUCIN1 immunohistochemical expression and MUCIN1 expression immunoreactivity pattern on histopathological grading of prostate J Sahmulia, LI Laksmi, JS Lukito - Correlation of MUCIN1 , 2021 - scholar.archive.orghttps://scholar.archive.org/work/4m6qduhf7jc5xixhuh6shiboxy/access/wayback/https://www.ijrp.org/filePermission/fileDownlaod/4/969d7ab28d358677fccbe8706226fc78/6 A fucose residue can mask the MUC-1 epitopes in normal and cancerous gastric mucosae J Bara, A Imberty , S Perez , K Imai - journal of cancer, 1993 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/ijc.2910540414 Synthesis of homogeneous MUC1 oligomers via a bi-directional ligation strategy D Al Sheikha, BL Wilkinson, G Santhakumar - Organic & , 2013 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2013/ob/c3ob41363b Cancer associated aberrant protein O-glycosylation can modify antigen processing and immune response CB Madsen, C Petersen, K Lavrsen, M Harndahl - PloS one, 2012 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0050139 Cancer Associated Aberrant Protein O-Glycosylation Can Modify Antigen Processing CB Madsen, C Petersen, K Lavrsen, M Harndahl - 2012 - academia.eduhttps://www.academia.edu/download/71402003/Cancer_Associated_Aberrant_Protein_O-Gly20211005-8386-1bm7nel.pdf Chemo-Enzymatic Production of O-Glycopeptides for the Detection of Serum Glycopeptide Antibodies A Nostdal, HH Wandall - Immunoproteomics: Methods and Protocols, 2013 - Springerhttps://link.springer.com/protocol/10.1007/978-1-62703-589-7_10

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL14 antibody, catalog no. 70R-3779

H-CGSGLNDVLGSIAY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGSGLNDVLGSIAY-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGSGLNDVLGSIAY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGSGLNDVLGSIAY-OH at the technical inquiry form on this page

Peptide H-TRPNNNTRKSINIGPGRALYTTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TRPNNNTRKSINIGPGRALYTTG-OH include the following: Immunization with wild-type or CD4-binding-defective HIV-1 Env trimers reduces viremia equivalently following heterologous challenge with simian-human C Sundling , S O'Dell, I Douagi , MN Forsell - Journal of , 2010 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01015-10 Human immunodeficiency virus type 1 env trimer immunization of macaques and impact of priming with viral vector or stabilized core protein A Mörner, I Douagi , MNE Forsell, C Sundling - Journal of , 2009 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/JVI.01102-08 HIV-1 Env-trimer immunization of macaques and impact of priming with viral vector or stabilized core protein A Mörner, I Douagi , MNE Forsell, C Sundling - 2008 - Citeseerhttps://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=dd1be2defd3f9fd0004e718455f5df5efe55638a

Purified Mouse anti-Horse Serum Amyloid A antibody.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Rabbit polyclonal Fibronectin antibody (HRP)

Please enquire for more information about 16:0 DBCO PE including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Rabbit polyclonal MKK4 antibody

rHuAcrp30 HEK

NSC 624206 is an inhibitor of the ubiquitin-proteasome pathway. It has been shown to be effective in experimental models of cancer and diabetes. NSC 624206 inhibits proteasome activity by binding to the catalytic subunit of the 20S proteasome, which leads to a decrease in ubiquitinated proteins and a reduction of inflammation in macrophages. The clinical response in diabetic patients with neuropathy was evaluated using a cross-over design, and it was found that there was a greater improvement in nerve conduction velocity when compared with placebo.

Enniatin Complex

HPV16 E6 pep11**m.

CDAN1 antibody was raised in Rabbit using Human CDAN1 as the immunogen

Peptide Ac-CAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-CAT-NH2 include the following: Localization and in vitro actions of atrial natriuretic peptide in the cat carotid body ZZ Wang, L He, LJ Stensaas - Journal of Applied , 1991 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/jappl.1991.70.2.942 The application of in vitro sperm competition test to evaluate the impact of ZP-derived peptides on fertilization capacity of cat sperm Y Niu , A Greube, W Ji , K Jewgenow - Theriogenology, 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0093691X06001440 BACE1 Inhibitor Peptides: Can an Infinitely Small kcat Value Turn the Substrate of an Enzyme into Its Inhibitor? Y Hamada, S Ishiura, Y Kiso - ACS Medicinal Chemistry Letters, 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ml2002373 Isolation and characterisation of renal metabolites of γ-glutamylfelinylglycine in the urine of the domestic cat (Felis catus) WH Hendriks, DRK Harding - and Physiology Part B , 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1096495904002313 Influence of"Alternative" C-terminal amino acids on the formation of [b3 + 17 + Cat]+ products from metal cationized synthetic tetrapeptides V Anbalagan, ATM Silva - Journal of mass , 2004 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.610 Cat allergen peptide immunotherapy reduces CD4+ T cell responses to cat allergen but does not alter suppression by CD4+ CD25+ T cells: a double-blind placebo TRF Smith, C Alexander, AB Kay, M Larche - Allergy, 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1398-9995.2004.00601.x Studies on the location and release of cholecystokinin and vasoactive intestinal peptide in rat and cat spinal cord TL Yaksh, EO Abay II, VLW Go - Brain Research, 1982 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0006899382903110 Fel d 1-derived synthetic peptide immuno-regulatory epitopes show a long-term treatment effect in cat allergic subjects P Couroux, D Patel, K Armstrong - Clinical & , 2015 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/cea.12488 Role of peptide histidine isoleucine in relaxation of cat lower esophageal sphincter P Biancani, MC Beinfeld, C Hillemeier, J Behar - Gastroenterology, 1989 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0016508589916752 Development and preliminary clinical evaluation of a peptide immunotherapy vaccine for cat allergy M Worm, HH Lee, J Kleine-Tebbe , RP Hafner - Journal of Allergy and , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674910018488 Distribution and effects of pituitary adenylate cyclase activating peptide in cat and human lower oesophageal sphincter. L Ny , B Larsson, P Alm, P Ekström - British journal of , 1995 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC1909198/ Conjugating catalytic polyproline fragments with a self-assembling peptide produces efficient artificial hydrolases KY Huang, CC Yu, JC Horng - Biomacromolecules, 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.biomac.9b01620 Isolation and characterization of a felinine-containing peptide from the blood of the domestic cat (Felis catus) KJ Rutherfurd, SM Rutherfurd , PJ Moughan - Journal of Biological , 2002 - ASBMBhttps://www.jbc.org/article/S0021-9258(20)87987-3/abstract A hypoallergenic cat vaccine based on Fel d 1-derived peptides fused to hepatitis B PreS K Niespodziana, M Focke-Tejkl, B Linhart - Journal of allergy and , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0091674911002636 Effects of soybean antioxidant peptides (SAP) on SOD, GSH-Px, CAT activity and MDA level in vivo J Wang, RW Yang, JB Liu, SY Lin - Advanced Materials Research, 2014 - Trans Tech Publhttps://www.scientific.net/AMR.1025-1026.476 The amino terminal acetylation of cat globin chains and their tryptic peptides J Kasten-Jolly, F Taketa - Life sciences, 1984 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0024320584901723 Cat gastrinoma and the sequence of cat gastrins J Eng, BH Du, GF Johnson, S Kanakamedala - Regulatory peptides, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167011592900594 Purification and amino acid sequence of motilin from cat small intestine I Depoortere, TL Peeters, A Vandermeers - Regulatory peptides, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016701159390380Q Proadrenomedullin NH2-terminal 20 peptide has direct vasodilator activity in the cat HC Champion, WA Murphy, DH Coy - American Journal of , 1997 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpregu.1997.272.4.r1047 challenge protocol of the allergic rhinitis clinical investigator collaborative (AR-CIC): validation in a clinical trial of cat synthetic peptide immunoregulatory epitopes (Cat H Neighbour, M Larche , L Steacy - Journal of Allergy and , 2015 - jacionline.orghttps://www.jacionline.org/article/S0091-6749(14)03182-0/abstract nano-LC-ESI-FTICR-MS method for comprehensive characterization of endogenous fragments from amyloid beta and amyloid precursor protein in human and cat G Brinkmalm , E Portelius, A aca–hrfelt - Journal of Mass , 2012 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/jms.2987 Fel d 1 peptides: effect on skin tests and cytokine synthesis in cat-allergic human subjects FER Simons, M Imada, Y Li, WTA Watson - International , 1996 - academic.oup.comhttps://academic.oup.com/intimm/article-abstract/8/12/1937/673690 The tryptic peptide composition of the beta chains of hemoglobins A and B of the domestic cat (Felis catus) F Taketa, AG Mauk, MR Mauk, B Brimhall - Journal of molecular evolution, 1977 - Springerhttps://link.springer.com/article/10.1007/BF01796114 The cis-effect of a nascent peptide on its translating ribosome: influence of the cat-86 leader pentapeptide on translation termination at leader codon 6 EJ Rogers, PS Lovett - Molecular microbiology, 1994 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2958.1994.tb01007.x An inhibitory tripeptide from cat spinal cord CJ Lote, JP Gent, JH Wolstencroft, M Szelke - Nature, 1976 - nature.comhttps://www.nature.com/articles/264188a0 Structure of cat islet amyloid polypeptide and identification of amino acid residues of potential significance for islet amyloid formation C Betsholtz , L Christmanson, U Engström - Diabetes, 1990 - Am Diabetes Assochttps://diabetesjournals.org/diabetes/article-abstract/39/1/118/8758 T cell peptide therapy induces recruitment of CD4+CD25+; CD4+ interferon-γ+ T helper type 1 cells to sites of allergen-induced late-phase skin reactions in cat C Alexander, S Ying, A B. Kay - Clinical & Experimental , 2005 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2222.2005.02143.x Allergen immunotherapy with cat allergen peptides A Barry Kay, M Larche - Springer Seminars in Immunopathology, 2004 - Springerhttps://link.springer.com/article/10.1007/s00281-003-0146-y

ORM-10962 is a potent inhibitor of human kinases that has been shown to be effective against a variety of cancer cell lines. It inhibits the activity of several kinases, including quetiapine and somatostatin, which are involved in tumor growth and proliferation. ORM-10962 induces apoptosis in cancer cells by blocking the kinase activity required for cell survival. This analog has been shown to inhibit the growth of Chinese hamster ovary cells in vitro and to reduce tumor size in vivo. ORM-10962 has also been found to inhibit hyaluronan synthesis, which is involved in cancer cell migration and invasion. In addition, ORM-10962 has potential as a biomarker for cancer diagnosis due to its presence in urine samples from cancer patients.

C1ORF110 antibody was raised using the middle region of C1Orf110 corresponding to a region with amino acids SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Rabbit polyclonal RARB antibody

2-Acetamido-6-chloro-9-(2,3,5-tri-O-acetyl-?-D-ribofuranosyl)purine

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf54 antibody, catalog no. 70R-3576

TrkC antibody was raised in goat using the entire extracellular domain of rat TrkC receptor as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYT9 antibody, catalog no. 70R-7051

Purified recombinant TIMM8A protein (His tag)

VIP is a polypeptide that belongs to the vasoactive intestinal peptide family. VIP is a potent stimulator of adenylate cyclase, which increases intracellular cAMP levels and activates protein kinase A. VIP has been shown to interact with ion channel receptors, such as the nicotinic acetylcholine receptor, and regulate membrane potentials in neuronal cells. It also functions as a ligand for G protein-coupled receptors and can be used as an immunogen or antibody against VIP. VIP has been shown to have a variety of pharmacological effects including the ability to stimulate cell proliferation and inhibit apoptosis. VIP has also been shown to function as an activator of latent TGF-β1, which may play a role in tumor suppression.

Peptide H-WVDGTDYETGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WVDGTDYETGFK-OH include the following: Rapid depletion of -œcatch-and-release- anti-ASGR1 antibody in vivo SC Devanaboyina , P Li, EL LaGory, C Poon-Andersen- Mabs, 2024 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2024.2383013

6-Benzylaminopurine solution (1.0 mg/mL)

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R1A antibody, catalog no. 70R-6079

A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-3776

A synthetic peptide for use as a blocking control in assays to test for specificity of Bnip3l antibody, catalog no. 70R-9618

APP antibody was raised in goat using a peptide; RGRTSSKELAI, as the immunogen.

Please enquire for more information about C.I.Reactive Yellow 162 including the price, delivery time and more detailed product information at the technical inquiry form on this page

ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA

Purified recombinant Human OCT4 protein (His tag)

Purified Polyclonal RASSF2 antibody

Goat anti-human IgG (HRP) was raised in goat using human IgG gamma chain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SPAG8 antibody, catalog no. 70R-2385

Purified Polyclonal NKX21 antibody

Purified recombinant GEMIN6 protein (His tag)

TSH antibody is a growth factor that plays a crucial role in regulating thyroid function. It interacts with annexin, TGF-beta, and interferon to modulate the production and release of thyroid hormones. This monoclonal antibody has shown promising results in the treatment of thyroid disorders such as hypothyroidism and Graves' disease. TSH antibody also exhibits potential therapeutic effects in other areas of medicine, including neurology and oncology. Its unique mechanism of action involves targeting specific receptors on thyroid cells, leading to the inhibition of hormone synthesis and secretion. With its high specificity and affinity for TSH receptors, this antibody offers a promising avenue for personalized medicine in the field of endocrinology.

A synthetic peptide for use as a blocking control in assays to test for specificity of NOV antibody, catalog no. 70R-1715

Ac-SSTGSIDMVD-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SSTGSIDMVD-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SSTGSIDMVD-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SSTGSIDMVD-NH2 at the technical inquiry form on this page

Peptide H-DIEVQGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DIEVQGFR^-OH include the following: A novel mass spectrometry method for the absolute quantification of several cytochrome P450 and uridine 5'-diphospho-glucuronosyltransferase enzymes in the Y Lv, H Zhang, G Wang, C Xia , F Gao , Y Zhang - Analytical and , 2020 - Springerhttps://link.springer.com/article/10.1007/s00216-020-02445-7 Defining human pathways of drug metabolism in vivo through the development of a multiple humanized mouse model N Scheer, Y Kapelyukh, A Rode, S Oswald - Drug Metabolism and , 2015 - ASPEThttps://dmd.aspetjournals.org/content/43/11/1679.short Mass spectrometry-based absolute quantification of microsomal cytochrome P450 2D6 in human liver E Langenfeld, UM Zanger , K Jung , HE Meyer - , 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200800680 Optimization and validation of a label-free MRM method for the quantification of cytochrome P450 isoforms in biological samples A Al Ali , D Touboul , JP Le Caaca«r - Analytical and , 2014 - Springerhttps://link.springer.com/article/10.1007/s00216-014-7928-z

This 19 amino acid fragment of myelin basic protein (MBP) can induce experimental allergic encephalomyelitis (EAE) in Lewis rats. EAE is the most commonly used experimental model for studying the human inflammatory demyelinating disease, multiple sclerosis (MS).MBP is an integral component of myelin found in the central nervous system (CNS). MBP is considered vital for the development and stability of the myelin sheath where it plays a role in membrane adhesion. MPBs constitute an extraordinarily varied collection of splice isoforms which show a myriad of post-translational modifications. MBP may be targeted by auto-antibodies in diseases such as multiple sclerosis. The low affinity of MBP (1-9) peptide for MCH class II molecules may result in MBP autoreactive T cells escaping central-tolerance, where self-reactive T cells are usually eliminated.

Mouse monoclonal GOLM1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LIPJ antibody, catalog no. 70R-4117

Inhibits anti-apoptotic protein MCL1; antineoplastic

TAS-116 is a cytosolic inhibitor that disrupts the chaperone function of Hsp90. TAS-116 has potent antitumor activity in mouse tumor models and significant cytotoxicity against human stromal tumours. This drug inhibits epidermal growth factor (EGF) receptor signaling, which may be due to its ability to inhibit the ATPase activity of Hsp90. TAS-116 also interacts with the ATPase domain of Hsp90 and binds to two amino acid residues on the surface of the ATPase domain, which are important for substrate binding. These interactions have been shown to be critical for TAS-116’s inhibition of EGF receptor signaling and potent antitumor activity.

Please enquire for more information about Pristanic acid-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Phosphoserine antibody was raised in mouse using phosphoserine-KLH as the immunogen.

Peptide H-S^LSLSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-S^LSLSPGK^-OH include the following: Structural elucidation of post-translational modifications in monoclonal antibodies W Li, JL Kerwin, J Schiel, T Formolo - State-of-the-art and , 2015 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bk-2015-1201.ch003 Characterization of C-terminal and Disulfide Bond Peptides of Monoclonal Antibody (mAb) on Q-TOF Mass Spectrometer U Jumhawan, Z Zhan - shopshimadzu.comhttps://www.shopshimadzu.com/frontend/web/upload/2022/02/10/AD-01901644455294.pdf Native mass spectrometry combined with enzymatic dissection unravels glycoform heterogeneity of biopharmaceuticals T Wohlschlager , K Scheffler, IC Forstenlehner - Nature , 2018 - nature.comhttps://www.nature.com/articles/s41467-018-04061-7 Attribute analytics performance metrics from the MAM consortium interlaboratory study T Mouchahoir, JE Schiel, R Rogers - Journal of the , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jasms.2c00129 chromatography mass spectrometry with a heavy peptide response curve accurately measures unprocessed C-terminal lysine during peptide mapping analysis of T Greer , ROB Johnson, M Cejkov, X Zheng - Journal of Pharmaceutical , 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708521000753 LC-MS based case-by-case analysis of the impact of acidic and basic charge variants of bevacizumab on stability and biological activity SK Singh , D Kumar , H Malani , AS Rathore - Scientific reports, 2021 - nature.comhttps://www.nature.com/articles/s41598-020-79541-2 Characterization of a complex glycoprotein whose variable metabolic clearance in humans is dependent on terminal N-acetylglucosamine content R Keck, N Nayak, L Lerner, S Raju, S Ma - Biologicals, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1045105607000735 C-terminal modification of monoclonal antibody drugs: amidated species as a general product-related substance M Tsubaki, I Terashima, K Kamata, A Koga - International journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0141813012003704 C-terminal lysine variants in fully human monoclonal antibodies: Investigation of test methods and possible causes LW Dick Jr , D Qiu, D Mahon, M Adamo - Biotechnology and , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/pdf/10.1002/bit.21855 Monoclonal antibody charge variant characterization by fully automated four-dimensional liquid chromatography-mass spectrometry L Verscheure, A Cerdobbel, P Sandra , F Lynen - of Chromatography A, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967321005331 The versatility of heart-cutting and comprehensive two-dimensional liquid chromatography in monoclonal antibody clone selection K Sandra , M Steenbeke, I Vandenheede - of Chromatography A, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021967317309202 Peptide Mapping of Monoclonal Antibodies and Antibody--Drug Conjugates Using Micro-Pillar Array Columns Combined with Mass Spectrometry. K Sandra , J Vandenbussche, I Vandenheede - LC-GC , 2018 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=14716577&AN=128570176&h=CvpM%2F%2FaZiJQbDZ%2BbiA53%2B2Lq7HvJm47meP%2FEuSaj5B72EbssU0j7ssJEoVl30dX9ZyasQcCwnZK0vPGPDbEQLQ%3D%3D&crl=c Characterizing Monoclonal Antibodies and Antibody-Drug Conjugates Using 2D-LC-MS. K Sandra , I Vandenheede, M Steenbeke - LC-GC , 2017 - search.ebscohost.comhttps://search.ebscohost.com/login.aspx?direct=true&profile=ehost&scope=site&authtype=crawler&jrnl=14716577&AN=121933182&h=kjupPM0spnP7Gi7x6T2ToZBElNE%2BZ%2FyKaWEdnYydRYY4fEdOvMAbmey%2FAnCBoxNBs6xrN%2BB9oQvyTEZAVvrLJA%3D%3D&crl=c Investigation of the correlation between charge and glycosylation of IgG1 variants by liquid chromatography-mass spectrometry JM Yang, J Ai, Y Bao, Z Yuan, Y Qin, YW Xie, D Tao - Analytical , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269713005642 Antibody characterization using novel ERLIC-MS/MS-based peptide mapping J Zhen, J Kim, Y Zhou, E Gaidamauskas - MAbs, 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/19420862.2018.1505179 Monoclonal Antibodies and Biosimilars-A Selection of Analytical Tools for Characterization and Comparability Assessment I Vandenheede, P Sandra , K Sandra - LCGC , 2015 - chromatographyonline.comhttps://www.chromatographyonline.com/view/monoclonal-antibodies-and-biosimilars-selection-analytical-tools-characterization-and-comparabilit-0 Monoclonal Antibodies and Biosimilars-A Selection of Analytical Tools for Characterization and Comparability Assessment I Vandenheede, P Sandra , K Sandra, E Dumont - 2016 - chromatographyonline.comhttps://www.chromatographyonline.com/view/monoclonal-antibodies-and-biosimilars-selection-analytical-tools-characterization-and-comparabilit-1 Peptide map of monoclonal antibodies and antibody-drug conjugates using micro-pillar array columns combined with mass spectrometry I Vandenheede, P Sandra , G Desmet, W De Malsche - 2018 - chromatographyonline.comhttps://www.chromatographyonline.com/view/peptide-mapping-monoclonal-antibodies-and-antibody-drug-conjugates-using-micro-pillar-array-columns Peptide Mapping of Monoclonal Antibodies and Antibody-Drug Conjugates Using Micro-Pillar Array Columns Combined with Mass Spectrometry I Vandenheede, P Sandra , G Desmet, W De Malsche - 2018 - chromatographyonline.comhttps://www.chromatographyonline.com/view/peptide-mapping-monoclonal-antibodies-and-antibody-drug-conjugates-using-micro-pillar-array-column-2 Similarity demonstrated between isolated charge variants of MB02, a biosimilar of bevacizumab, and Avastin® following extended physicochemical and functional I Ruppen, ME Beydon, C Solaca­s, D Sacristan - Biologicals, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1045105621000786 The second life of antibodies EV Navolotskaya - Biochemistry (Moscow), 2014 - Springerhttps://link.springer.com/article/10.1134/S0006297914010015 Detection and identification of a serine to arginine sequence variant in a therapeutic monoclonal antibody D Ren, J Zhang, R Pritchett, H Liu, J Kyauk - of Chromatography B, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1570023211005411 Observation of Heavy-Chain C-Terminal Des-GK Truncation in Recombinant and Human Endogenous IgG4 B Shah, YX Zhu , J Wypych, Z Zhang - Journal of Pharmaceutical Sciences, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022354923001922 Observation of heavy-chain C-terminal amidation in human endogenous IgG B Shah, M Li, J Wypych, MK Joubert, Z Zhang - Journal of Pharmaceutical , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022354922002568 C-terminal lysine processing of human immunoglobulin G2 heavy chain in vivo B Cai, H Pan, GC Flynn - Biotechnology and bioengineering, 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bit.22933

Peptide H-QIYGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-QIYGAK-OH include the following: A microRNA signature in circulating exosomes is superior to exosomal glypican-1 levels for diagnosing pancreatic cancer X Lai , MU Wang , SD McElyea, S Sherman, M House - Cancer letters, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0304383517301283

Tirofiban is a platelet aggregation inhibitor drug that is used for the prevention of thrombotic events in acute coronary syndrome. This drug is an antagonist of fibrinogen and inhibits it from binding to the glycoprotein IIb/IIIa receptor. As a result of this, Tirofiban blocks the blood from clotting during a cardiovascular event. Tirofiban HCl monohydrate is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Affinity purified Rabbit polyclonal PKC alpha antibody

Peptide H-YPI^PPPDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YPI^PPPDAK-OH include the following: Allosteric MEK inhibitors act on BRAF/MEK complexes to block MEK activation GL Gonzalez-Del Pino , K Li , E Park - Proceedings of the , 2021 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.2107207118

SARS coronavirus antibody was raised in mouse using nucleoprotein of the SARS virus as the immunogen.

Peptide H-GNLAAASDIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GNLAAASDIVR^-OH include the following: Development Of Peptide Inhibitors Targeting Clostridium Difficile Toxins A/b And Characterizing The Regulatory Role Of A Putative Negative Regulator Tcdc In SJ Abdeen - 2013 - digitalcommons.wayne.eduhttps://digitalcommons.wayne.edu/cgi/viewcontent.cgi?article=1626&context=oa_dissertations

Mouse monoclonal FAM84B antibody

Purified Polyclonal STAM2 antibody

Rabbit polyclonal TPMT antibody

SCH772984

Rabbit polyclonal TrkC antibody (Tyr516)