Compuestos y reactivos bioquímicos

Catalogue peptide; min. 95% purity

PLA1A antibody was raised using the middle region of PLA1A corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY

D-(+)-Glucose, monohydrate

Peptide H-CRPEYTPIHLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CRPEYTPIHLS-OH include the following: A small molecular activator of cardiac hypertrophy uncovered in a chemical screen for modifiers of the calcineurin signaling pathway E Bush, J Fielitz , L Melvin - Proceedings of the , 2004 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0308723101

C7orf10 antibody was raised in Rabbit using Human C7orf10 as the immunogen

TBX5 antibody was raised in Mouse using a purified recombinant fragment of TBX5 expressed in E. coli as the immunogen.

Peptide H-VDPLETELGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VDPLETELGVK^-OH include the following: Angelman syndrome patient neuron screen identifies a potent and selective clinical ASO targeting UBE3A-ATS with long lasting effect in cynomolgus monkey R Jagasia , C Bon, SV Rasmussen, S Badillo, D Tehler - bioRxiv, 2022 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/2022.06.09.495066.abstract

HRP Conjugated Goat anti-Rat IgE antibody:Zhou C. et al. Allergenicity of recombinant human lactoferrin to an animal model Brown Norway ratsFood and agricultural immunology; ISSN : 1465-3443 Raju A et al.Evaluation of anti asthmatic activity of hydro alcoholic extract of Citrullus colocynths and Cucumis trigonus fruits.J App Pharm Sci. 2015; 5(8): 126-130 doi: 10.7324/JAPS.2015.50819

H-SGNILTIRLTAADHR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGNILTIRLTAADHR-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGNILTIRLTAADHR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGNILTIRLTAADHR-OH at the technical inquiry form on this page

Rabbit polyclonal Oncostatin M antibody (FITC)

Rabbit Polyclonal KRCC1 antibody

Mouse monoclonal ITFG2 antibody

HIV1 gp41 antibody (HRP) was raised in goat using recombinant ectodomain of gp41 as the immunogen.

ANKRD9 antibody was raised using the middle region of ANKRD9 corresponding to a region with amino acids RARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLGHGASPGLRDGGGL

Spermine Dihydrate

A synthetic peptide for use as a blocking control in assays to test for specificity of RPIA antibody, catalog no. 70R-4423

Purified recombinant MUTY protein (His tag)

Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GDLIAEVETDK^ATV-OH include the following: The role of xenobiotics in primary biliary cirrhosis O Park - 2005 - search.proquest.comhttps://search.proquest.com/openview/7963bf4fec557cd9159154e5920484ba/1?pq-origsite=gscholar&cbl=18750&diss=y Sidechain biology and the immunogenicity of PDC-E2, the major autoantigen of primary biliary cirrhosis TK Mao, PA Davis , JA Odin, RL Coppel - ..., 2004 - Wiley Online Libraryhttps://aasldpubs.onlinelibrary.wiley.com/doi/pdf/10.1002/hep.20491 Promiscuous T cells selected by Escherichia coli: OGDC-E2 in primary biliary cirrhosis H Tanimoto, S Shimoda, M Nakamura, H Ishibashi- Journal of ..., 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0896841103000246 Antimitochondrial antibodies in primary biliary cirrhosis: the role of xenobiotics SA Long, J Van de Water , ME Gershwin - Autoimmunity Reviews, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1568997201000209 Immunopathogenesis of primary biliary cirrhosis A Nishio, EB Keeffe, ME Gershwin - Seminars in liver disease, 2002 - thieme-connect.comhttps://www.thieme-connect.com/products/ejournals/html/10.1055/s-2002-34506 Primary biliary cirrhosis: lessons learned from an organic-specific disease A Nishio, EB Keeffe, ME Gershwin - Clinical and experimental medicine, 2001 - Springerhttps://link.springer.com/article/10.1007/s102380100000 The lymphoid liver: considerations on pathways to autoimmune injury H Kita, J Van De Water , ME Gershwin , IR Mackay - Gastroenterology, 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0016508501182715 ME GERSHWIN, S. SHIMODA, H. ISHIBASHI and RL COPPEL - Hepatology 2000, 2000 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=CxaSFFO67VAC&oi=fnd&pg=PA37&dq=(%22H-Gly-Asp-Leu-Ile-Ala-Glu-Val-Glu-Thr-Asp-Lys-Ala-Thr-Val-acid%22+OR+%22GDLIAEVETDKATV%22+OR+%22H-GDLIAEVETDKATV-OH%22+OR+%22GDLIAEVETDK%5EATV%22+OR+%22Gly-Asp-Leu-Ile-Ala-Glu-Val-Glu-Thr-Asp-Lys-Ala-Thr-Val%22)+AND+peptide&ots=nMWI87u8_6&sig=rnuBxdMFeRVPWvOEnMNWMopg4JU ME GERSHWIN, S. SHIMODA, H. ISHIBASHI and RL COPPEL - Hepatology 2000, 2000 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=CxaSFFO67VAC&oi=fnd&pg=PA37&dq=(%22H-Gly-Asp-Leu-Ile-Ala-Glu-Val-Glu-Thr-Asp-Lys-Ala-Thr-Val-acid%22+OR+%22GDLIAEVETDKATV%22+OR+%22H-GDLIAEVETDKATV-OH%22+OR+%22GDLIAEVETDK%5EATV%22+OR+%22Gly-Asp-Leu-Ile-Ala-Glu-Val-Glu-Thr-Asp-Lys-Ala-Thr-Val%22)+AND+peptide&ots=nMWI87u9T8&sig=oy7r7HD0_QYykE-uPcuxfEFwF3k Primary biliary cirrhosis: Connecting molecular biology to clinical medicine S Reynoso-Paz, RL Coppel , Y Nakanuma- Clinical Reviews in ..., 2000 - Springerhttps://link.springer.com/article/10.1385/CRIAI:18:2:241 Primary biliary cirrhosis: an orchestrated immune response against epithelial cells ME Gershwin , AA Ansari, IR Mackay- Immunological ..., 2000 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1600-0528.2002.017402.x æŠ-ミトコンドリアæŠ-体対応æŠ-原 æ, 2000 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/jscc1971b/29/4/29_162/_article/-char/ja/ Mucosal aspects of primary biliary cirrhosis LS Reynoso-Paz - 1999 - search.proquest.comhttps://search.proquest.com/openview/159275ecc94638e0dcec0661c2f75c55/1?pq-origsite=gscholar&cbl=18750&diss=y Immunoreactivity of porcine heart dihydrolipoamide acetyl-and succinyl-transferases (PDC-E2, OGDC-E2) with primary biliary cirrhosis sera: Characterization K Koike, H Ishibashi, M Koike - Hepatology, 1998 - Wiley Online Libraryhttps://aasldpubs.onlinelibrary.wiley.com/doi/pdf/10.1002/hep.510270602 Identification and precursor frequency analysis of a common T cell epitope motif in mitochondrial autoantigens in primary biliary cirrhosis. S Shimoda, J Van de Water , A Ansari- The Journal of ..., 1998 - Am Soc Clin Investighttps://www.jci.org/articles/view/4213

Rabbit polyclonal MAPKAPK2 antibody (Thr334)

Rabbit anti-Human PIEZO1 Polyclonal antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM45 antibody, catalog no. 70R-2222

2-Acetamido-1,3,4,6-tetra-O-acetyl-2-deoxy-D-glucopyranose

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC730950 antibody, catalog no. 70R-9033

Please enquire for more information about Anti-KCNK18/TRESK antibody - 2mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal SMARCD2 antibody

Circumdatin A is an analog of a protein found in human urine that has been shown to have potent anticancer activity. It induces apoptosis (programmed cell death) in cancer cells by inhibiting kinases, which are enzymes that regulate cellular processes. Circumdatin A has been identified as a promising medicinal compound for the treatment of cancer due to its ability to selectively target tumor cells and inhibit their growth. It is derived from a Chinese medicinal plant and has been studied extensively for its potential as an inhibitor of various kinases involved in cancer development and progression. Circumdatin A represents a promising new class of anticancer agents with the potential to significantly improve cancer treatment outcomes.

H-TKILEPFRAQNPELV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TKILEPFRAQNPELV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TKILEPFRAQNPELV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TKILEPFRAQNPELV-OH at the technical inquiry form on this page

Rabbit polyclonal UBC9 antibody (HRP)

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

RBM4 antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids LQQQPLLLLLQLPLHITGGIGAPCVALQPQSPLLERATVTGMRVSCPKLQ

Rabbit Polyclonal HIV1 protease antibody; 1mg/ml; Supplied in frozen form.

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

Cep 1347

Purified Polyclonal Focal Adhesion Kinase antibody

N-Acetyl-L-arginine

Mouse monoclonal Erythropoetin antibody

Rabbit polyclonal Gamma enolase antibody (HRP)

Purified Rabbit polyclonal PPP1CB antibody

Vasopressin-like peptide

CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.

BSA conjugated Thyroxine Hapten

Mouse monoclonal SSR4 antibody

The IGHG1 MS Calibrator-4 is a tryptic peptide that is a product of the Ig gamma-1 chain C region. This peptide is used as a calibrator for mass spectrometry. The IGHG1 MS Calibrator-4 contains Biologically Active Peptides, which can be used to identify the presence of proteins in biological samples. The New England Peptide Company offers peptides for use in proteomics, such as the IGHG1 MS Calibrator-4.

Cache Valley virus (CVV) is an orthobunyavirus and an important animal pathogen. Periodic outbreaks of CVV have resulted in the significant loss of lambs on North American farms. It is geographically distinct from another orthobunyavirus, Kairi virus (KRIV) which is mainly found in South and Central America. Cache Valley has become a sour name over the past few years in the sheep industry. As the name states, this disease is caused by a virus and therefore is challenging to control. Animals contract CVV in the fall during or after the breeding season. Cache Valley is spread via mosquitos and biting midges. Ewes and does that are infected during early pregnancy may either reabsorb or abort their fetuses. Those that carry to full term usually result in stillbirth that have severe deformities. Unfortunately, at this time there is no vaccine available for this virus. Human can also be infected by CVV. In human hosts, this virus is neuroinvasive and can cause central nervous system diseases, such as encephalitis and meningitis and can even be potential fatal in rare cases. In virus-endemic areas there appears to be a high infection rate, specifically up to 18% of the population.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A1 antibody, catalog no. 70R-7365

Sphinganine-d7 is a stable isotope-labeled analog of sphinganine, which is a bioactive lipid used extensively in biochemistry and molecular biology. This compound is derived from the natural sphingolipid backbone, with six deuterium atoms incorporated to facilitate tracking and measurement in scientific studies. The mode of action involves its role as a precursor in the biosynthesis of more complex sphingolipids, which are crucial components of cell membranes and play a role in signaling pathways. Sphinganine-d7 is primarily used in lipidomic research, aiding in the quantification and metabolic tracing of sphingolipids within biological systems. With its deuterium labeling, it serves as an internal standard in mass spectrometry, providing precise and accurate measurements of sphingolipid metabolism under various physiological and pathological conditions. This compound is invaluable in studying the dynamics of lipid metabolism and understanding lipid-associated diseases, contributing to insights into cellular mechanisms and potential therapeutic targets.

Please enquire for more information about Fmoc-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse sequence expressed in E. coli Cells; purity >97% by SDS-PAGE and HPLC.

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM121B antibody, catalog no. 70R-1480

RSV antibody was raised in rabbit using whole RSV virions (subgroup A-Long strain) as the immunogen.

This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.

Rabbit Polyclonal IFI16 antibody

Cilengitide is a cyclic arginine-glycine-aspartic acid (RGD) motif containing peptide that selectively inhibits the integrin alphav subunit. Integrins are cell adhesion molecules which mediate cell-cell and cell-matrix interactions and creating a scaffold for tissue organisation. Integrins also act to regulate cell attachment, proliferation, differentiation, apoptosis and motility.Integrin alphav can form heterodimers with integrin subunits subunits β1, β3, β5, β6, or β8. Cilengitide is a highly specific antagonist of alphavβ3 and alphavβ5 integrins. It also and shows anti-angiogenic effects and inhibits growth and promotes apoptosis of tumour cells that express integrins, such as glioblastoma.Cilengitide has gone on to phase II trials for cancers such as glioblastoma, melanoma, prostate, breast, lung and head and neck cancers.

Ivacaftor O-?-D-glucuronide

Pura antibody was raised in rabbit using the C terminal of Pura as the immunogen

Rabbit polyclonal RDH11 antibody

H-MSNTLLSAW-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MSNTLLSAW-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MSNTLLSAW-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MSNTLLSAW-OH at the technical inquiry form on this page

Please enquire for more information about Anitrazafen including the price, delivery time and more detailed product information at the technical inquiry form on this page

EG-VEGF protein containing 86 amino acids.

Antagonist of OX1 orexin receptor

H-VTHTYLESGSVTAQVV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VTHTYLESGSVTAQVV-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VTHTYLESGSVTAQVV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VTHTYLESGSVTAQVV-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RDH11 antibody, catalog no. 70R-5410

Rabbit anti-rat IgG (FITC) was raised in rabbit using rat IgG F(c) fragment as the immunogen.

Rabbit polyclonal AROS antibody (HRP)

ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Peptide H-GAPINSATAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GAPINSATAM-OH include the following: Distinct Differences in the Expansion and Phenotype of TB10.4 Specific CD8 and CD4 T Cells after Infection with Mycobacterium tuberculosis TTKT Hoang, A Nansen, S Roy, R Billeskov - PloS one, 2009 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0005928 Nonlytic Fc-fused IL-7 synergizes with Mtb32 DNA vaccine to enhance antigen-specific T cell responses in a therapeutic model of tuberculosis SS Ahn , BY Jeon, SJ Park, DH Choi, SH Ku, SN Cho - Vaccine, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X13004684 Tracking antigen-specific CD8 T lymphocytes in the lungs of mice vaccinated with the Mtb72F polyprotein SM Irwin, AA Izzo, SW Dow , YAW Skeiky - Infection and , 2005 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/iai.73.9.5809-5816.2005 Tuberculosis vaccine development; from mouse to man S Reed, Y Lobet - Microbes and infection, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1286457905000997 Culture filtrate proteins from BCG act as adjuvants for cytotoxic T lymphocyte induction S Mizuno, Y Chuma, Y Shibuya, S Horibata - Frontiers in , 2023 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fimmu.2023.1271228/full CD8 T cells show protection against highly pathogenic simian immunodeficiency virus (SIV) after vaccination with SIV gene-expressing BCG prime and vaccinia virus S Kato, H Shida, T Okamura, X Zhang, T Miura - Journal of , 2021 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01718-20 An inclusion membrane protein from Chlamydia trachomatis enters the MHC class I pathway and stimulates a CD8+ T cell response MN Starnbach, WP Loomis, P Ovendale - The Journal of , 2003 - journals.aai.orghttps://journals.aai.org/jimmunol/article/171/9/4742/78308 Identification of sex differences in tumor-specific T cell infiltration in bladder tumor-bearing mice treated with BCG immunotherapy M Rousseau, CJO O'brien, E Antequera - Bladder , 2020 - content.iospress.comhttps://content.iospress.com/articles/bladder-cancer/blc200384 Combination of Host Susceptibility and Virulence of Mycobacterium tuberculosis Determines Dual Role of Nitric Oxide in the Protection and Control of Inflammation M Beisiegel, M Kursar, M Koch - The Journal of , 2009 - academic.oup.comhttps://academic.oup.com/jid/article-abstract/199/8/1222/804376 Impact of inducible co-stimulatory molecule (ICOS) on T-cell responses and protection against Mycobacterium tuberculosis infection G Nouailles , TA Day, S Kuhlmann - European journal of , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201040608 Accelerated induction of mycobacterial antigen-specific CD8+ T cells in the Mycobacterium tuberculosis-infected lung by subcutaneous vaccination with D Begum, M Umemura, A Yahagi, Y Okamoto - , 2009 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1365-2567.2009.03141.x IFN-γ from CD4 T cells is essential for host survival and enhances CD8 T cell function during Mycobacterium tuberculosis infection AM Green, R DiFazio , JAL Flynn - The Journal of Immunology, 2013 - journals.aai.orghttps://journals.aai.org/jimmunol/article/190/1/270/86478 Targeting Mycobacterium tuberculosis tumor necrosis factor alpha-downregulating genes for the development of antituberculous vaccines A Olsen, Y Chen, Q Ji, G Zhu, AD De Silva , C Vilchacašze - MBio, 2016 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/mbio.01023-15 The adaptor molecule CARD9 is essential for tuberculosis control A Dorhoi, C Desel, V Yeremeev, L Pradl - Journal of Experimental , 2010 - rupress.orghttps://rupress.org/jem/article-abstract/207/4/777/40679

γ-cyclodextrin phosphate sodium salt (DS~2-6)

Rabbit polyclonal TAS2R48 antibody

H-RNWGQASLECLRMGSSLV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RNWGQASLECLRMGSSLV-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RNWGQASLECLRMGSSLV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RNWGQASLECLRMGSSLV-OH at the technical inquiry form on this page

H-DTLMISR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DTLMISR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DTLMISR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DTLMISR-OH at the technical inquiry form on this page

Peptide H-SSNENGRPPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SSNENGRPPL-OH include the following: CDK/ERK-mediated phosphorylation of the human influenza A virus NS1 protein at threonine-215 BG Hale , A Knebel, CH Botting , CS Galloway - Virology, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0042682208006570

Rabbit polyclonal PSTPIP1 antibody

Purified recombinant RWDD4 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA1 antibody, catalog no. 70R-4395

Purified homogeneous preparation of rhodamine conjugated Streptavidin protein

Rabbit polyclonal HNF1B antibody

H-YAQPAAAAAAYSDSYGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YAQPAAAAAAYSDSYGR-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YAQPAAAAAAYSDSYGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YAQPAAAAAAYSDSYGR-OH at the technical inquiry form on this page

Peptide H-VLNQEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VLNQEL^R-OH include the following: A human axillary odorant is carried by apolipoprotein D. C Zeng, AI Spielman , BR Vowels - Proceedings of the , 1996 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.93.13.6626 Discovery and initial verification of differentially abundant proteins between multiple sclerosis patients and controls using iTRAQ and SID-SRM AC Kroksveen, E Aasebo, H Vethe , V Van Pesch - Journal of , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391912006938

Peptide H-TRFQTLLALHRSYLT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TRFQTLLALHRSYLT-OH include the following: Assessment of SARS-CoV-2 specific CD4 (+) and CD8 (+) T cell responses using MHC class I and II tetramers Y Poluektov, M George, P Daftarian, MC Delcommenne - Vaccine, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264410X21002760 Molecular mimicry between SARS-CoV-2 and the female reproductive system A Dotan , D Kanduc, S Muller - American Journal of , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/aji.13494

Rabbit polyclonal SH2 antibody

CD107a antibody (FITC) was raised in rat using murine CD107a (LAMP-1) as the immunogen.

Peptide H-VDFTLSSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VDFTLSSER-OH include the following: PUBLISHED IN JOURNAL OF PERSONALIZED MEDICINE IE Acar , E Willems , E Kersten - Omics studies in age , 2022 - repository.ubn.ru.nlhttps://repository.ubn.ru.nl/bitstream/handle/2066/246881/246881.pdf?sequence=1#page=144 Absolute quantification of proteins in complex matrices thanks to a universal standardization kit and differential PTMs evaluation for biomarker discovery studies F Baumans - 2023 - orbi.uliege.behttps://orbi.uliege.be/bitstream/2268/303414/1/BAUMANS_PhDThesis.pdf

Fresh tissue lysate isolated from the striatum of human brain

BSA (Bovine Serum Albumin) is a hormone peptide and globulin that plays a crucial role in various biological processes. It is widely used in the field of Life Sciences for research purposes. BSA has been extensively studied for its emission properties and molecular docking capabilities. It is often utilized as a colloidal stabilizer and blocking agent in immunoassays, particularly in the development of diagnostic reagents. In addition to its stabilizing functions, BSA is an essential component in many biochemical assays and experiments. It is commonly employed as a standard protein for calibration purposes due to its high purity and well-characterized structure. BSA also serves as an electrode modifier, enabling the detection of active agents or biomolecules with enhanced sensitivity. Furthermore, BSA finds applications in the production of monoclonal antibodies and native proteins, serving as a critical ingredient for their formulation and stabilization. Its compatibility with human serum makes it an ideal candidate for various diagnostic reagents used in clinical settings. Overall,

HDAC8-IN-1 is a small molecule inhibitor of class I histone deacetylases (HDACs). It is a potent inhibitor of HDAC8, the most abundant HDAC in the human genome. In vitro studies have shown that HDAC8-IN-1 inhibits self-renewal and differentiation of cancer stem cells. In vivo, HDAC8-IN-1 treatment inhibited tumor growth in mouse models of leukemia and breast cancer. The pharmacological inhibition of HDAC8 with HDAC8-IN-1 has been shown to inhibit expression of genes involved in cell cycle regulation, angiogenesis, metastasis, and immune suppression.

Myostatin antibody was raised in Mouse using a purified recombinant fragment of Myostatin expressed in E. coli as the immunogen.

H-SMFYDGWAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SMFYDGWAK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SMFYDGWAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SMFYDGWAK-OH at the technical inquiry form on this page

PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS

Recombinant human DUSP21 protein (His tag)

Eriodictyol

Rabbit polyclonal BTF3 antibody (biotin)

Mouse monoclonal PRKDC antibody

Mouse sequence expressed in E. coli Cells; purity >95% by SDS-PAGE and analyzed by silver stain.

Peptide H-YLDHWLGAPAPYPDPLEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YLDHWLGAPAPYPDPLEPK-OH include the following: Determination of osteocalcin in meat and bone meal of bovine and porcine origin using matrix-assisted laser desorption ionization/time-of-flight mass spectrometry G Balizs, C Weise, C Rozycki, T Opialla, S Sawada - Analytica chimica , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003267011003990

Rabbit polyclonal LRP antibody

Portion of EBV

Rabbit polyclonal RNF170 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf21 antibody, catalog no. 70R-4193

Peptide H-AVLGTSNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AVLGTSNFK^-OH include the following: In silico spectral libraries by deep learning facilitate data-independent acquisition proteomics Y Yang , X Liu , C Shen , Y Lin , P Yang, L Qiao - Nature communications, 2020 - nature.comhttps://www.nature.com/articles/s41467-019-13866-z

Normal Human Serum (Pool) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Normal Human Serum (Pool) including the price, delivery time and more detailed product information at the technical inquiry form on this page.

m-dPEG®12-Azide (Azido-m-dPEG®12) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®12-Azide (Azido-m-dPEG®12) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Purified Polyclonal Somatostatin antibody

Furacilinum metabolite-OVA

A synthetic peptide for use as a blocking control in assays to test for specificity of F13B antibody, catalog no. 70R-5445

Stichodactyla toxin is a peptide that binds to neuronal ion channels and inhibits the transmission of nerve impulses. It has been shown to bind to the nicotinic acetylcholine receptor (nAChR) and inhibit ligand-gated ion channels, such as glutamate receptors. Stichodactyla toxins have been used as research tools in pharmacology and protein interactions. This toxin may be an inhibitor of cell proliferation, or an activator of apoptosis. The high purity of this toxin makes it suitable for antibody production.

Affinity purified goat polyclonal hCG alpha antibody

Recombinant human IL-10

Peptide H-AHHPIWARMDA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AHHPIWARMDA-OH include the following: Role and function of granin proteins in diabetes mellitus Z Herold , M Doleschall , A Somogyi - World Journal of Diabetes, 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8311481/ An all-in-one nanomedicine consisting of CRISPR-Cas9 and an autoantigen peptide for restoring specific immune tolerance YL Luo, LF Liang, YJ Gan, J Liu , Y Zhang - Applied Materials & , 2020 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsami.0c10885 Idd9/11 Genetic Locus Regulates Diabetogenic Activity of CD4 T-Cells in Nonobese Diabetic (NOD) Mice YG Chen , F Scheuplein, MA Osborne, SW Tsaih - Diabetes, 2008 - Am Diabetes Assochttps://diabetesjournals.org/diabetes/article-abstract/57/12/3273/12822 UBASH3A deficiency accelerates type 1 diabetes development and enhances salivary gland inflammation in NOD mice YG Chen , AE Ciecko, S Khaja, M Grzybowski - Scientific reports, 2020 - nature.comhttps://www.nature.com/articles/s41598-020-68956-6 Susceptible MHC alleles, not background genes, select an autoimmune T cell reactivity T Stratmann , N Martin-Orozco - The Journal of , 2003 - Am Soc Clin Investighttps://www.jci.org/articles/view/18337 Cutting edge: nonobese diabetic mice deficient in chromogranin A are protected from autoimmune diabetes RL Baker, B Bradley, TA Wiles, RS Lindsay - The Journal of , 2016 - journals.aai.orghttps://journals.aai.org/jimmunol/article/196/1/39/105061 Transient BAFF blockade inhibits type 1 diabetes development in nonobese diabetic mice by enriching immunoregulatory B lymphocytes sensitive to deletion by anti Q Wang, JJ Racine, JJ Ratiu , S Wang - The Journal of , 2017 - journals.aai.orghttps://journals.aai.org/jimmunol/article/199/11/3757/55133 Impaired Oral Tolerance Induction in Diabetes Prone but not in Diabetes Resistant Mice Revealed by Cholera Toxin Subunit B-Peptide Fusion Proteins M Presa, AZ Ortiz, N Garabatos - European journal of , 2013 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3856580/ Cholera toxin subunit B peptide fusion proteins reveal impaired oral tolerance induction in diabetes-prone but not in diabetes-resistant mice M Presa , AZ Ortiz, N Garabatos - European journal of , 2013 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201343633 Cutting edge: accelerated autoimmune diabetes in the absence of LAG-3 M Bettini , AL Szymczak-Workman, K Forbes - The Journal of , 2011 - journals.aai.orghttps://journals.aai.org/jimmunol/article/187/7/3493/85234 T cell recognition of weak ligands activates negative regulatory pathways LJ Edwards - 2011 - search.proquest.comhttps://search.proquest.com/openview/ca518e53681e149457c3ea4e7e25bf96/1?pq-origsite=gscholar&cbl=18750 Use of autoantigen-loaded phosphatidylserine-liposomes to arrest autoimmunity in type 1 diabetes I Pujol-Autonell, A Serracant-Prat, M Cano-Sarabia - PloS one, 2015 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0127057 Tolerance induction by liposomes targeting a single CD8 epitope IGRP206-214 in a model of type 1 diabetes is impeded by co-targeting a CD4+ islet epitope I Buckle , JD Loaiza Naranjo, AS Bergot - and Cell Biology, 2022 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/imcb.12506 beta-cell-specific IL-35 therapy suppresses ongoing autoimmune diabetes in NOD mice F Manzoor, MC Johnson , C Li - European journal of , 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/eji.201646493 Targeting of a T cell agonist peptide to lysosomes by DNA vaccination induces tolerance in the nonobese diabetic mouse EI Rivas, JP Driver , N Garabatos, M Presa - The Journal of , 2011 - journals.aai.orghttps://journals.aai.org/jimmunol/article/186/7/4078/85129

Tenofovir is a salt form of tenofovir that is used in the treatment and prevention of human immunodeficiency virus (HIV) infection. Tenofovir is a nucleotide analogue that inhibits viral DNA polymerase, which prevents viral replication. Tenofovir has been shown to be effective against HIV-1 as well as other viruses such as hepatitis B virus and herpes simplex virus type 2. The fumarate salt form of tenofovir, which is more stable than the phosphate salt form, can be used in the treatment of patients with renal dysfunction or kidney disease. The maleate salt form of tenofovir has been shown to be stable at high temperatures and industrial conditions. This drug also has antiviral effects when it is irradiated, leading to the formation of adenine derivatives that inhibit viral DNA synthesis.

Rabbit polyclonal CEBPE antibody

H-TGGVKKPHRY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TGGVKKPHRY-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TGGVKKPHRY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TGGVKKPHRY-OH at the technical inquiry form on this page

Mouse monoclonal ACSS2 antibody

Mouse monoclonal NRBP1 antibody

HSV IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HSV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Peptide H-KKKKKEGKKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KKKKKEGKKQ-OH include the following: A Pleiotrophin C-terminus peptide induces anti-cancer effects through RPTPbeta/ζ Z Diamantopoulou, O Bermek, A Polykratis - Molecular cancer, 2010 - Springerhttps://link.springer.com/article/10.1186/1476-4598-9-224 A basic peptide derived from the HARP C-terminus inhibits anchorage-independent growth of DU145 prostate cancer cells O Bermek, Z Diamantopoulou, A Polykratis - Experimental cell , 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0014482707003680

Rabbit polyclonal BCAP31 antibody (FITC)

MNAT1 antibody was raised in rabbit using the C terminal of MNAT1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SQLE antibody, catalog no. 70R-1955

Rabbit polyclonal GOLM1 antibody (biotin)

Rabbit polyclonal ATRIP antibody (Ser68/72)

Purified recombinant Human CKB protein

Please enquire for more information about Talabostat including the price, delivery time and more detailed product information at the technical inquiry form on this page