Compuestos y reactivos bioquímicos

Mouse monoclonal NOP1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GNL3 antibody, catalog no. 70R-3045

Recombinant Human UBE2E3 protein with His tag

A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM19 antibody, catalog no. 70R-7210

H-RYVPRSCGSNSYVLVPV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RYVPRSCGSNSYVLVPV-OH is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RYVPRSCGSNSYVLVPV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RYVPRSCGSNSYVLVPV-OH at the technical inquiry form on this page

Fmoc-Lys(Me)3-OH chloride

Rabbit polyclonal MNK1 antibody (Thr255)

ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

3-(Boc-amino)piperidine is used as an organic chemical synthesis intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPV5 antibody, catalog no. 70R-5176

Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH include the following: Characterizations of a neutralizing antibody broadly reactive to multiple gluten peptide: HLA-DQ2. 5 complexes in the context of celiac disease Y Okura, Y Ikawa-Teranishi, A Mizoroki - Nature , 2023 - nature.comhttps://www.nature.com/articles/s41467-023-44083-4 Tetramer visualization of gut-homing gluten-specific T cells in the peripheral blood of celiac disease patients M Raki, LE Fallang, M Brottveit - Proceedings of the , 2007 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0608610104 The effects of ALV003 pre-digestion of gluten on immune response and symptoms in celiac disease in vivo JA Tye-Din, RP Anderson , RA Ffrench , GJ Brown - Clinical , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1521661609008651 Inhibition of HLA-DQ2-mediated antigen presentation by analogues of a high affinity 33-residue peptide from alpha2-gliadin J Xia , M Siegel , E Bergseng, LM Sollid - Journal of the American , 2006 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ja056423o Equilibrium and kinetic analysis of the unusual binding behavior of a highly immunogenic gluten peptide to HLA-DQ2 J Xia , LM Sollid , C Khosla - Biochemistry, 2005 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi047747c On the IgA antibody response to gluten in celiac disease aca˜ Steinsbo - 2015 - duo.uio.nohttps://www.duo.uio.no/handle/10852/48199

A synthetic peptide for use as a blocking control in assays to test for specificity of CLIon Channel5 antibody, catalog no. 70R-1515

Rabbit polyclonal ORC1L antibody

4-Methylumbelliferyl-α-D-galactopyranoside

WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG

N6AMT2 antibody was raised in Rabbit using Human N6AMT2 as the immunogen

Tos-PEG5-CH2CO2t-butyl ester

H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool