Produits biochimiques et réactifs

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM82A antibody, catalog no. 70R-3367

MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.

The Naproxen antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to actin, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity. One of the key applications of the Naproxen antibody is in immunofluorescence studies. By using this antibody, researchers can visualize actin filaments within cells, providing valuable insights into their organization and dynamics. The Naproxen antibody has also been used in Western blotting experiments to detect actin expression levels in different samples. In addition to its role in basic research, the Naproxen antibody has potential clinical applications as well. Studies have shown that aberrant actin expression is associated with certain diseases, including cancer. By using this antibody, researchers can investigate the role of actin in disease progression and potentially develop targeted therapies. Overall, the Naproxen antibody offers a reliable and versatile tool for studying act

Peptide Neurokinin B is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Neurokinin B include the following: Neurokinin B-related peptide suppresses the expression of GnRH I, Kiss2 and tac3 in the brain of mature female Nile tilapia Oreochromis niloticus YH Jin , JW Park, JH Kim, JY Kwon - Development & reproduction, 2016 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC4899558/ Syntheses and biological activities of neurokinin B analogs modified at positions 2, 3, and 6 Y Uchida, K Okimura, K Kurosawa - Bulletin of the , 1987 - academic.oup.comhttps://academic.oup.com/bcsj/article-abstract/60/4/1561/7364495 A cDNA encoding the precursor of the rat neuropeptide, neurokinin B TI Bonner, HU Affolter, AC Young - Molecular Brain Research, 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0169328X87900313 Distribution of neurokinin A-like and neurokinin B-like immunoreactivity in human peripheral tissues S Kishimoto, K Tateishi, H Kobayashi, K Kobuke - Regulatory peptides, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/016701159190054K Current and future applications of GnRH, kisspeptin and neurokinin B analogues RP Millar, CL Newton - Nature Reviews Endocrinology, 2013 - nature.comhttps://www.nature.com/articles/nrendo.2013.120 Endocytosis of the tachykinin neuropeptide, neurokinin B, in astrocytes and its role in cellular copper uptake R Shahzad, MR Jones, JH Viles , CE Jones - Journal of Inorganic , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0162013416300538 Structure-activity relationship study of tachykinin peptides for the development of novel neurokinin-3 receptor selective agonists R Misu, T Noguchi, H Ohno, S Oishi, N Fujii - Bioorganic & medicinal , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0968089613000758 Characterization of a neurokinin B receptor site in rat brain using a highly selective radioligand. R Laufer, C Gilon, M Chorev , Z Selinger - Journal of Biological Chemistry, 1986 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818675179 Neurokinin B in a human pheochromocytoma measured with a specific radioimmunoassay R Kage, JM Conlon - Peptides, 1989 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0196978189901666 Potent and highly selective neurokinin antagonists P Ward, GB Ewan, CC Jordan, SJ Ireland - Journal of medicinal , 1990 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/jm00169a003 Neurokinin B is hydrolysed by synaptic membranes and by endopeptidase-24.11 ('enkephalinase') but not by angiotensin converting enzyme NM Hooper, AJ Turner - FEBS letters, 1985 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0014579385804439 Neurokinin B and the hypothalamic regulation of reproduction NE Rance, SJ Krajewski, MA Smith, M Cholanian - Brain research, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006899310018731 The tachykinin NH2-senktide, a selective neurokinin B receptor agonist, is a very potent inhibitor of salt appetite in the rat M Massi , C Polidori, L Gentili, M Perfumi, G de Caro - Neuroscience , 1988 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0304394088906143 Neurokinin peptides and neurokinin receptors as potential therapeutic intervention targets of basal ganglia in the prevention and treatment of Parkinson's disease LW Chen, KKL Yung , YS Chan - Current Drug Targets, 2004 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/cdt/2004/00000005/00000002/art00009 Localization of the tachykinin neurokinin B precursor peptide in rat brain by immunocytochemistry and in situ hybridization LR Lucas, DL Hurley, JE Krause, RE Harlan - Neuroscience, 1992 - Elsevierhttps://www.sciencedirect.com/science/article/pii/030645229290318V Establishment of highly specific radioimmunoassays for neurokinin A and neurokinin B and determination of tissue distribution of these peptides in rat central nervous K Tateishi, Y Matsuoka, T Hamaoka - Regulatory peptides, 1989 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167011589902218 Measurement of neurokinin B by radioimmunoassay JM Conlon - Methods in Neurosciences, 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780121852610500198 Distribution of neurons expressing neurokinin B in the rat brain: immunohistochemistry and in situ hybridization J Marksteiner, G Sperk - Journal of Comparative , 1992 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/cne.903170403 Tachykinins (substance P, neurokinin A, neuropeptide K, and neurokinin B) in the cerebral circulation: vasomotor responses in vitro and in situ I Jansen , C Alafaci , J McCulloch - Journal of Cerebral , 1991 - journals.sagepub.comhttps://journals.sagepub.com/doi/abs/10.1038/jcbfm.1991.105 Neurokinin B peptide-2 neurons project from the hypothalamus to the thoracolumbar spinal cord of the rat H Zhuo, CJ Helke - Neuroscience, 1993 - Elsevierhttps://www.sciencedirect.com/science/article/pii/030645229390548T Regional distribution of neuropeptide K and other tachykinins (neurokinin A, neurokinin B and substance P) in rat central nervous system H Arai, PC Emson - Brain research, 1986 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0006899386915143 in fish model: receptor specificity and signal transduction for prolactin and somatolactin alpha regulation by neurokinin B (NKB) and NKB-related peptide in carp pituitary G Hu, M He, WKW Ko, C Lin , AOL Wong - Endocrinology, 2014 - academic.oup.comhttps://academic.oup.com/endo/article-abstract/155/9/3582/2423341 Selective agonists for substance P and neurokinin receptors G Drapeau, P D'Orleans-Juste, S Dion, NE Rhaleb - Neuropeptides, 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0143417987900886 Specific agonists for neurokinin B receptors G Drapeau, P d'Orleans-Juste, S Dion - European journal of , 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/001429998790313X The contractile activities of neurokinin A, B and related peptides on smooth muscles F Osakada, K Kubo, K Goto, I Kanazawa - European journal of , 1986 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0014299986905418 Ranakinin: A Novel NK1 Tachykinin Receptor Agonist Isolated with Neurokinin B from the Brain of the Frog Rana ridibunda F O'Harte , E Burcher, S Lovas , DD Smith - Journal of , 1991 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1471-4159.1991.tb06426.x Structure-activity studies of heptapeptide derivatives related to substance P, neurokinin A, B and other tachykinins on smooth muscles E Munekata, K Kubo, H Tanaka , F Osakada - Peptides, 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0196978187901823 Neurokinin B peptide serum levels are higher in normotensive pregnant women than in preeclamptic pregnant women D Schlembach, F Scalera, T Fischer, SG Marx - American journal of , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0002937803007750 The Tachykinin Peptide Neurokinin B Binds Copper Forming an Unusual [CuII(NKB)2] Complex and Inhibits Copper Uptake into 1321N1 Astrocytoma Cells D Russino, E McDonald , L Hejazi - ACS Chemical , 2013 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/cn4000988 The tachykinin peptide family C Severini, G Improta, G Falconieri-Erspamer - Pharmacological , 2002 - ASPEThttps://pharmrev.aspetjournals.org/content/54/2/285.short Investigating the role of phenylalanine residues for amyloid formation of the neuropeptide neurokinin B BM Jayawardena , A Azzi, CE Jones - Biochemical and Biophysical , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X24002687 Three dimensional structure of mammalian tachykinin peptide neurokinin B bound to lipid micelles AK Mantha , IR Chandrashekar , NZ Baquer - Journal of , 2004 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/07391102.2004.10506990 The tachykinin peptide neurokinin B binds copper (I) and silver (I) and undergoes quasi-reversible electrochemistry: towards a new function for the peptide in the brain AB Grosas , P Kalimuthu , AC Smith, PA Williams - Neurochemistry , 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0197018614000497

Peptide H-VYKYGGYNE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VYKYGGYNE-OH include the following: Cell type-specific synaptic encoding of ethanol exposure in the nucleus accumbens shell ZM Jeanes, TR Buske, RA Morrisett - Neuroscience, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S030645221400548X Hippocampal long-term depression mediates spatial reversal learning in the Morris water maze Z Dong, Y Bai, X Wu, H Li, B Gong , JG Howland - , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0028390812002857 Opposing mechanisms mediate morphine-and cocaine-induced generation of silent synapses NM Graziane, S Sun, WJ Wright , D Jang, Z Liu - Nature , 2016 - nature.comhttps://www.nature.com/articles/nn.4313 CCNP Heinz Lehmann Award Paper: Interference with AMPA receptor endocytosis: effects on behavioural and neurochemical correlates of amphetamine FY Choi , S Ahn, YT Wang, AG Phillips - Journal of Psychiatry and , 2014 - jpn.cahttps://www.jpn.ca/content/39/3/189.abstract Interference with AMPA receptor endocytosis: effects on behavioural and neurochemical correlates of amphetamine sensitization in male rats FY Choi , S Ahn, YT Wang , AG Phillips - Journal of Psychiatry & Neuroscience , 2014 - jpn.cahttps://www.jpn.ca/content/jpn/39/3/189.full-text.pdf Disruption of long-term depression potentiates latent inhibition: Key role for central nucleus of the amygdala DM Ashby , C Dias, LR Aleksandrova - International Journal , 2021 - academic.oup.comhttps://academic.oup.com/ijnp/article-abstract/24/7/580/6162669 Facilitated extinction of morphine conditioned place preference with Tat-GluA23Y interference peptide C Dias, YT Wang , AG Phillips - Behavioural brain research, 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166432812003646

H-GLKDLLNPI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLKDLLNPI-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLKDLLNPI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLKDLLNPI-OH at the technical inquiry form on this page

Purified Polyclonal CD284 antibody

Purified recombinant Human PDIA4 protein

Mouse monoclonal ARFGAP1 antibody

Rabbit polyclonal SPIN2B antibody

Purified recombinant TP63 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of ASAH1 antibody, catalog no. 70R-5483

Peptide H-SFFETGDQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFFETGDQLR-OH include the following: Detection of FGF15 in plasma by stable isotope standards and capture by anti-peptide antibodies and targeted mass spectrometry T Katafuchi , D Esterhazy , A Lemoff , X Ding, V Sondhi - Cell metabolism, 2015 - cell.comhttps://www.cell.com/cell-metabolism/pdf/S1550-4131(15)00216-8.pdf

Please enquire for more information about N-[4-(4-Methoxyphenyl)-2-thiazolyl]-4-[2-(4-morpholinyl)-2-oxoethoxy]benzamide including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-AFYLAGGVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AFYLAGGVPR-OH include the following: Comprehensive quantification of sesame allergens in processed food using liquid chromatography-tandem mass spectrometry X Ma, H Li, J Zhang, W Huang, J Han, Y Ge, J Sun - Food Control, 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0956713519303251

Rabbit Polyclonal LEPREL2 antibody

H-DKKEDEEDGGDGNKTLSI-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DKKEDEEDGGDGNKTLSI-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DKKEDEEDGGDGNKTLSI-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DKKEDEEDGGDGNKTLSI-NH2 at the technical inquiry form on this page

MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT

Recombinant human CHMP4A protein (His tag)

Purified Rabbit polyclonal NACAD antibody

H-CRIPVIVAD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CRIPVIVAD-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CRIPVIVAD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CRIPVIVAD-OH at the technical inquiry form on this page

ADO antibody was raised in Rabbit using Human ADO as the immunogen

Rabbit polyclonal Cofilin antibody (Ser3)

Biotin-[2H2] (Vitamin H)

A synthetic peptide for use as a blocking control in assays to test for specificity of Prdm12 antibody, catalog no. 70R-9558

Imidazole-15N2 is an analog of the calcium channel blocker nifedipine that has been shown to have anticancer properties. It induces apoptosis in cancer cells by inhibiting protein kinases, which are involved in tumor growth and survival. Imidazole-15N2 has been studied in both Chinese hamster ovary cells and human cancer cell lines, where it has demonstrated potent inhibition of kinase activity. This drug is a promising candidate for the development of novel cancer therapies due to its ability to selectively target cancer cells while sparing normal cells. Imidazole-15N2 can be detected in urine and may serve as a biomarker for the presence of protein kinase inhibitors in the body.

Inhibitor of cyclin D kinases Cdk4 and Cdk6; antineoplastic

Peptide H-LEETVQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LEETVQAK-OH include the following: ZCH-2B8a, an antibody targeting actin-binding protein coronin-1a, is a potential therapeutic agent for B-lineage malignancies XJ Xu, YM Tang, HZ Zhao, L Guo- Journal of drug ..., 2014 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.3109/1061186X.2014.888072

SYTL1 antibody was raised in rabbit using the N terminal of SYTL1 as the immunogen

Peptide H-VESTAGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VESTAGSL-OH include the following: ESAT-6 and the Mycobacterial ESX Secretion Systems I Rosenkrands, D Bottai, P Andersen - The Mycobacterial Cell , 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1128/9781555815783.ch13 Recombinant BCG coexpressing Ag85B, CFP10, and interleukin-12 induces multifunctional Th1 and memory T cells in mice CWEI LIN, IHJEN SU, JIARU CHANG, YIHY CHEN - Apmis, 2012 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1600-0463.2011.02815.x Cytolytic CD8+ T Cells Recognizing CFP10 Are Recruited to the Lung after Mycobacterium tuberculosis Infection AB Kamath, J Woodworth, X Xiong, C Taylor - The Journal of , 2004 - rupress.orghttps://rupress.org/jem/article-abstract/200/11/1479/54290

Peptide H-LLIYDASNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LLIYDASNR-OH include the following: A validated LC-MS/MS method for the quantitation of daratumumab in rat serum using rapid tryptic digestion without IgG purification and reduction W Li, W Huang, X Yu, C Chen, Y Yuan, D Liu - of Pharmaceutical and , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0731708524001237 Pharmacokinetic analysis of a novel human EGFRvIII: CD3 bispecific antibody in plasma and whole blood using a high-resolution targeted mass spectrometry TH Schaller, MW Foster , JW Thompson - Journal of proteome , 2019 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.9b00145 Integration of protein L-immobilized epoxy magnetic bead capture with LC-MS/MS for therapeutic monoclonal antibody quantification in serum R Cao, S Xu, Z Yu, L Xu, Z Ge, Q Huo, G Zhu - Analytical , 2024 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2024/ay/d4ay00433g Validated LC-MS/MS analysis of immune checkpoint inhibitor Nivolumab in human plasma using a Fab peptide-selective quantitation method: nano-surface N Iwamoto, T Shimada, H Terakado - Journal of Chromatography , 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S157002321630277X Augmented clearance of nivolumab is associated with renal functions in chronic renal disease model rats K Taguchi, Y Hayashi, M Ohuchi, H Yamada - Drug Metabolism and , 2022 - ASPEThttps://dmd.aspetjournals.org/content/50/6/822.abstract

CDK7-IN-1 is a potent and selective inhibitor of the human cyclin-dependent kinase 7 (CDK7) protein, which is involved in cell cycle regulation. This analog has shown anticancer activity in Chinese hamster ovary cells and has been identified as a potential anticancer drug candidate. CDK7-IN-1 is a potent inhibitor of tumor growth and induces apoptosis in cancer cells. It has been shown to be effective against a variety of cancers, including breast, lung, and ovarian cancer. This inhibitor also exhibits high selectivity for CDK7 over other kinases, making it an attractive target for cancer therapy. Additionally, CDK7-IN-1 has low toxicity and is excreted primarily in urine, making it a promising candidate for further development as an anticancer agent.

4-Nitrophenyl Conjugate for use in immunoassays

H-VLMGNIASGAEPYIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLMGNIASGAEPYIK-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLMGNIASGAEPYIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLMGNIASGAEPYIK-OH at the technical inquiry form on this page

Purified recombinant Treponema pallidum protein

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of VARS antibody, catalog no. 70R-3182

Region of IFN Lambda 2 protein corresponding to amino acids MDPVPRATRL PVEAKDCHIA QFKSLSPKEL QAFKKAKDAI EKRLLEKDMR CSSHLISRAW DLKQLQVQER PKALQAEVAL TLKVWENMTD SALATILGQP LHTLSHIHSQ LQTCTQLQAT AEPKPPSRRL SRWLHRLQEA QSKETPGCLE DSVTSNLFRL LTRDLKCVAS GDQCV.

Purified Polyclonal Neuromedin S antibody

E2F8 antibody was raised in Rabbit using Human E2F8 as the immunogen

CHRFAM7A antibody was raised in Rabbit using Human CHRFAM7A as the immunogen

Purified Rabbit polyclonal MPK12 antibody

Ac-SLSLSPGSLATPSR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SLSLSPGSLATPSR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SLSLSPGSLATPSR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SLSLSPGSLATPSR-OH at the technical inquiry form on this page

Rabbit anti-rat IgG was raised in rabbit using rat IgG F(c) fragment as the immunogen.

Purified native Bovine Troponin I protein (Cardiac)

L-Leucine 7-amido-4-methylcoumarin hydrochloride salt

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A11 antibody, catalog no. 70R-7369

Mouse monoclonal POLR2J2 antibody

IL6 antibody was raised in rabbit using highly pure recombinant rat IL-6 as the immunogen.

The Ubiquitin antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets ubiquitin, a small protein involved in various cellular processes. This antibody has been extensively studied and validated for its specificity and sensitivity. Ubiquitin antibodies are commonly used in research to study the role of ubiquitin in protein degradation pathways, cell signaling, and disease mechanisms. They are particularly useful in studying the ubiquitin-proteasome system, which is responsible for targeted protein degradation within cells. This antibody can be applied in various experimental techniques such as immunoblotting, immunoprecipitation, immunofluorescence, and flow cytometry. It has been successfully used to detect ubiquitin conjugates in different tissues and cell types. In addition to its application in basic research, the Ubiquitin antibody has potential clinical applications. It can be used as a diagnostic tool to detect specific biomarkers associated with diseases such as cancer or neurodegenerative

Peptide H-ILYENNVIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ILYENNVIT-OH include the following: Cancer therapy using tumor-associated antigens to reduce side effects D Siu - Clinical and experimental medicine, 2009 - Springerhttps://link.springer.com/article/10.1007/s10238-009-0047-z Real-time polymerase chain reaction monitoring of epithelial cell adhesion molecule-induced T-cell stimulation in patients with lung cancer and healthy individuals A Trojan, M Urosevic, R Dummer - Journal of , 2002 - journals.lww.comhttps://journals.lww.com/immunotherapy-journal/fulltext/2002/05000/real_time_polymerase_chain_reaction_monitoring_of.9.aspx Functional detection of epithelial cell adhesion molecule specific cytotoxic T lymphocytes in patients with lung cancer, colorectal cancer and in healthy donors A Trojan, A Tun-Kyi, B Odermatt, FO Nestle, RA Stahel - Lung Cancer, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0169500201004780

Liposomes are vesicles that are composed of one or more concentric lipid bilayers. These structures are used to deliver drugs and other molecules to a particular target cell, typically by binding to proteins on the outside of the cell membrane or through endocytosis. Liposomes can be made from a variety of lipids, including phospholipids and glycolipids. The most common type is made from egg phosphatidylcholine (PC).

Azelastine is an antihistamine drug that is used to treat allergic rhinitis. It inhibits the production of inflammatory mediators such as histamine and leukotrienes. It antagonizes the actions of histamine, resulting in relief of allergy symptoms. Azelastine has been shown to inhibit mediators of mast cell degranulation like leukotrienes in the nasal lavage of patients with rhinitis and possesses mast cell-stabilizing qualities that limit the production of interleukin-6, tryptase, histamine, and TNF-alpha2 from mast cells. Azelastine HCl is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

Mouse monoclonal TYRO3 antibody

Methyl 5-[2-(2,5-dimethoxyphenyl)ethyl]-2-hydroxybenzoate is a methyl ester that is used in research as an olefination agent. It has been shown to have anti-cancer properties, and is being studied for its potential use in pharmaceuticals. It is a white crystalline solid that can be prepared by the elimination of dimethyl acetate in the presence of ethanol at room temperature. This compound has been shown to be effective against hyperproliferative cells and cancer cells. Methyl 5-[2-(2,5-dimethoxyphenyl)ethyl]-2-hydroxybenzoate can also be used as a precursor to produce 5-formylsalicylic acid which is an intermediate in the synthesis of aspirin. Novartis Pharmaceuticals produces this compound on a large scale using hydrogenation with Raney nickel catalyst.

H-SDIQTKELQKQITKI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SDIQTKELQKQITKI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SDIQTKELQKQITKI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SDIQTKELQKQITKI-OH at the technical inquiry form on this page

Recombinant Human RPL35 protein

Mouse monoclonal CAPN9 antibody

Mouse monoclonal CARM1 antibody

Rabbit polyclonal NGAL antibody (HRP)

Purified Polyclonal Estrogen Receptor alpha antibody

Kallikrein 2 Monoclonal Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CERKL antibody, catalog no. 70R-9906

The Estriol antibody is a powerful tool used in research and diagnostics. It is an antibody that specifically targets estriol, a hormone found in the human body. This antibody has been extensively studied for its role in various physiological processes. One of the key characteristics of the Estriol antibody is its antiangiogenic properties. It has been shown to inhibit the formation of new blood vessels, which is crucial for tumor growth and metastasis. Additionally, this antibody has been found to interact with collagen and actin filaments, two important components of the extracellular matrix. Moreover, the Estriol antibody has been shown to modulate dopamine release and collagenase activity. It can also regulate the expression of various growth factors and receptors, such as ketanserin and endothelial growth factor receptors. In addition to its role in angiogenesis and tissue remodeling, this antibody has also been studied for its potential therapeutic applications. For example, it has been investigated as a potential treatment for conditions related to abnormal

KRT10 antibody was raised in Rabbit using Human KRT10 as the immunogen

Please enquire for more information about KYT-36 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal p21Cip1 antibody

H-YLLPAIVHI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YLLPAIVHI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YLLPAIVHI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YLLPAIVHI-OH at the technical inquiry form on this page

Tenovin-6 is a methyltransferase inhibitor that inhibits the BCR-ABL kinase. Tenovin-6 also has inhibitory properties on cell nuclei and autophagy, which are processes that regulate energy metabolism. Tenovin-6 has been shown to have transcriptional regulation and receptor activity in vitro. It has been shown to have inhibitory effects on cancer cells derived from human serum and other cell lines.

Purified Rat IgG (Fab'2) HRP conjugate

Rabbit polyclonal T4S1 antibody

Peptide H-GVYDGREHTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GVYDGREHTV^-OH include the following: A MAGE-A4 peptide presented by HLA-B37 is recognized on human tumors by cytolytic T lymphocytes Y Zhang , V Stroobant, V Russo, T Boon - Tissue , 2002 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-0039.2002.600503.x Peptide Terminus Tilting: an Unusual conformational transition of MHC Class I Revealed by Molecular Dynamics Simulations Y Sun , P Tian - bioRxiv, 2017 - biorxiv.orghttps://www.biorxiv.org/content/10.1101/219873.abstract Identification of O-glycosylated decapeptides within the MUC1 repeat domain as potential MHC class I (A2) binding epitopes T Ninkovic, L Kinarsky, K Engelmann, V Pisarev - Molecular , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589008007001 New MAGE-4 antigenic peptide recognized by cytolytic T lymphocytes on HLA-A1 tumor cells T Kobayashi, C Lonchay, D Colau, N Demotte - Tissue , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-0039.2003.00123.x Large-scale molecular dynamics simulations of HLA-A*0201 complexed with a tumor-specific antigenic peptide: Can the alpha3 and beta2m domains be neglected? S Wan , P Coveney , DR Flower - Journal of computational , 2004 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jcc.20100 High-resolution structure of HLA-A∗ 0201 in complex with a tumour-specific antigenic peptide encoded by the MAGE-A4 gene RC Hillig, PG Coulie , V Stroobant, W Saenger - Journal of Molecular , 2001 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283601948168 Structural insights into engineering a T-cell receptor targeting MAGE-A10 with higher affinity and specificity for cancer immunotherapy PC Simister, EC Border , JF Vieira - for Immunotherapy of , 2022 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC9295655/ Theoretical Dynamics and Energetics of HLA-A2/SLYNTVATL Interaction O Olaposi, H Tsuyoshi - American Journal of Bioinformatics Research, 2015 - academia.eduhttps://www.academia.edu/download/70861651/10.5923.j.bioinformatics.20150501.01.pdf A MAGE-A4 peptide presented by HLA-A2 is recognized by cytolytic T lymphocytes MT Duffour, P Chaux, C Lurquin - European journal of , 1999 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/(SICI)1521-4141(199910)29:10%3C3329::AID-IMMU3329%3E3.0.CO;2-7 A library of cancer testis specific T cell receptors for T cell receptor gene therapy MAJ de Rooij, DFG Remst, DM van der Steen - Molecular Therapy , 2023 - cell.comhttps://www.cell.com/molecular-therapy-family/oncology/fulltext/S2372-7705(22)00142-5 de, Remst, DFG, Steen, DM an der, Wouters M Rooi - K., Hagedoorn, RS, Kester, MGD , 2023 - scholarlypublications https://scholarlypublications.universiteitleiden.nl/access/item%3A3616927/download Development of a CD8 co-receptor independent T-cell receptor specific for tumor-associated antigen MAGE-A4 for next generation T-cell-based K Davari, T Holland, L Prassmayer - for Immunotherapy of , 2021 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC7996660/ Unconventional modes of peptide-HLA-I presentation change the rules of TCR engagement JR Hopkins, BJ MacLachlan , S Harper - Discovery , 2022 - academic.oup.comhttps://academic.oup.com/discovimmunology/article-abstract/1/1/kyac001/6580421 Preclinical evaluation of an affinity-enhanced MAGE-A4-specific T-cell receptor for adoptive T-cell therapy JP Sanderson , DJ Crowley, GE Wiedermann - , 2020 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/2162402X.2019.1682381 The physiological interactome of TCR-like antibody therapeutics in human tissues E Marrer-Berger, A Nicastri, A Augustin - Nature , 2024 - nature.comhttps://www.nature.com/articles/s41467-024-47062-5 A de-risking experimental framework defines the physiological interactome of TCR-based therapeutics in human tissues E Marrer-Berger, A Nicastri , A Augustin, V Pulko - 2022 - researchsquare.comhttps://www.researchsquare.com/article/rs-1828302/latest

TNIK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Brucella IgM Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Brucella IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Goat polyclonal Human CRP antibody

GPC4 antibody was raised in mouse using recombinant human GPC4 (401-529aa) purified from E. coli as the immunogen.

Peptide H-LRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LRK-OH include the following: Natural inhibitors from earthworms for the crystallization of calcium oxalate monohydrate X Kang, S Li, M Li, J Li, D Han, J Gong - CrystEngComm, 2022 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2022/ce/d2ce00630h Highly specific, membrane-permeant peptide blockers of cGMP-dependent protein kinase Ialpha inhibit NO-induced cerebral dilation WRG Dostmann , MS Taylor, CK Nickl - Proceedings of the , 2000 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.97.26.14772 Chaperone complex BAG2-HSC70 regulates localization of Caenorhabditis elegans leucine-rich repeat kinase LRK-1 to the Golgi T Fukuzono, SI Pastuhov , O Fukushima, C Li - Genes to , 2016 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/gtc.12338 Diversification of Lrk/Tak kinase gene clusters is associated with subfunctionalization and cultivar-specific transcript accumulation in barley P Hu, RP Wise - Functional & integrative genomics, 2008 - Springerhttps://link.springer.com/article/10.1007/s10142-008-0077-8 Bioinspired self-assembling peptide hydrogel with proteoglycan-assisted growth factor delivery for therapeutic angiogenesis LC Huang, HC Wang , LH Chen, CY Ho , PH Hsieh - Theranostics, 2019 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC6815956/ Cloning, characterization and expression analysis of the receptor-like kinase gene (RLK) in common wheat J Niu, L Zhang , Y Wang, D Hong - Journal of Plant Physiology and , 2006 - researchgate.nethttps://www.researchgate.net/profile/Ji-Shan-Niu/publication/7300135_Cloning_characterization_and_expression_analysis_of_the_receptor-like_kinase_gene_RLK_in_common_wheat/links/58c88aec45851591df3dedb3/Cloning-characterization-and-expression-analysis-of-the-receptor-like-kinase-gene-RLK-in-common-wheat.pdf Overexpression of the leucine-rich receptor-like kinase gene LRK2 increases drought tolerance and tiller number in rice J Kang, J Li, S Gao, C Tian, X Zha - Plant biotechnology journal, 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/pbi.12707 Structural basis for activation of human lymphocyte kinase Lck upon tyrosine phosphorylation H Yamaguchi, WA Hendrickson - Nature, 1996 - nature.comhttps://www.nature.com/articles/384484a0 Molecular cloning and characterization of a gene coding for a putative receptor-like protein kinase with a Leucine-rich repeat expressed in inflorescence and root H Kanamoto, J Hattan, M Takemura , A YOKOTA - Plant , 2002 - jstage.jst.go.jphttps://www.jstage.jst.go.jp/article/plantbiotechnology/19/2/19_2_113/_article/-char/ja/ Peptide signaling in vascular development H Fukuda , Y Hirakawa , S Sawa - Current opinion in plant biology, 2007 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1369526607001227 MKK6 binds and regulates expression of Parkinson's disease-related protein LRRK2 CH Hsu, D Chan, E Greggio , S Saha - Journal of , 2010 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1471-4159.2010.06568.x Probing the roles of LRR RLK genes in Arabidopsis thaliana roots using a custom T-DNA insertion set CA Ten Hove, Z Bochdanovits, VMA Jansweijer - Plant molecular , 2011 - Springerhttps://link.springer.com/article/10.1007/s11103-011-9769-x Molecular characterization of a new type of receptor-like kinase (wlrk) gene family in wheat C Feuillet, C Reuzeau, P Kjellbom , B Keller - Plant molecular biology, 1998 - Springerhttps://link.springer.com/article/10.1023/A:1006062016593 A novel LRR-RLK (CTLK) confers cold tolerance through regulation on the C-repeat-binding factor pathway, antioxidants, and proline accumulation B Geng, Q Wang, R Huang, Y Liu, Z Guo - The Plant , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/tpj.15535

FP prostaglandin receptor agonist

Recombinant Human Matrix Metalloproteinase-7

Affinity purified Rabbit polyclonal VATPase C2 antibody

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

EDN1 antibody was raised in Rabbit using Human EDN1 as the immunogen

Cystatin C Light Tryptic Peptide Standard for use in protein identification and quantitation studies. Cystatin C is a non-glycosylated, basic protein which can be used as a biomarker to determine kidney function.

Rabbit polyclonal ACL6A antibody

Affinity purified Rabbit polyclonal GLYATL1 antibody

Phenobarbital m/p Conjugate for use in immunoassays

Mouse IgA heavy chain antibody was raised in rat using murine IgA as the immunogen.

Peptide H-SFSTASAITPSVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFSTASAITPSVSR^-OH include the following: MALDI mass spectrometry imaging reveals decreased CK5 levels in vulvar squamous cell carcinomas compared to the precursor lesion differentiated vulvar C Zhang, G Arentz , L Winderbaum , NA Lokman - International Journal of , 2016 - mdpi.comhttps://www.mdpi.com/1422-0067/17/7/1088

VU 0422288 is a drug that is being studied for the treatment of Alzheimer's disease and other neurological disorders. It is an inhibitor of the metabotropic glutamate receptor (mGluR) type 5 and has been shown to be a potent activator of mGluRs. In animal models, VU 0422288 has been shown to protect against cognitive impairment and reduce amyloid beta production in the brain. It also reduces inflammation in the brain and spinal cord, which may contribute to its therapeutic effects. This drug is not effective for treating dementia or Alzheimer's disease, but it may be useful for treating autoimmune diseases.

Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TESTLNALLQR^-OH include the following: Neuronal pentraxin 2, brain atrophy and cognitive decline A Swanson - 2017 - search.proquest.comhttps://search.proquest.com/openview/dfaffccfcb236524da4e5ca02b6592c7/1?pq-origsite=gscholar&cbl=18750

EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ