Prodotti biochimici e reagenti
I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole
- Per obiettivo biologico
- Per uso/effetti farmacologici
- Composti relativi alla crioconservazione e crioconservanti
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati
- Ormoni
- Biologia vegetale
- Metaboliti secondari
Prodotti di "Prodotti biochimici e reagenti"
Ordinare per
AGK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AGK antibody, catalog no. 70R-3532Purezza:Min. 95%TM5441
CAS:TM5441 is an experimental molecule that is a small-molecule inhibitor of the enzyme PAI-1. The inhibition of PAI-1 by TM5441 has been shown to induce apoptosis in cancer cells, as well as inhibit tumor growth. TM5441 has also been shown to reduce cardiac hypertrophy and reverse metabolic disorders caused by fatty acid overload. This drug has not been tested in humans, but it has been shown to be safe for use in mice and rats. The following products are available at our store: 6-Fluoro-3-indoxyl-beta-D-galactopyranoside Tilmicosin 3-Desacetylcefotaxime potassium GatifloxacinFormula:C21H17ClN2O6Purezza:Min. 95%Peso molecolare:428.82 g/molOR13C5 antibody
OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogenPurezza:Min. 95%Slc7a3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Slc7a3 antibody, catalog no. 70R-8576Purezza:Min. 95%CD80 antibody (FITC)
CD80 antibody (FITC) was raised in mouse using transformed B Lymphoblastoid cells as the immunogen.Influenza A antibody
The Influenza A antibody is a monoclonal antibody used in the field of life sciences. It is commonly used for research purposes and has various applications in the study of influenza A virus. This antibody specifically targets and binds to antigens associated with the influenza A virus, allowing for the detection and analysis of viral proteins. Monoclonal antibodies like the Influenza A antibody have revolutionized scientific research by providing highly specific tools for studying various biological processes. They are widely used in immunohistochemistry, flow cytometry, and other techniques to identify and characterize specific molecules or cells. The Influenza A antibody can be used in combination with other antibodies or reagents to develop diagnostic tests or therapeutic interventions against influenza A infections. Its high affinity and specificity make it a valuable tool for researchers working on understanding the mechanisms of viral infection, developing vaccines, or testing antiviral drugs. In addition to its applications in virology, this monoclonal antibody has also been2-Azidoethyl 2,3,4,6-tetra-O-acetyl-β-D-glucopyranoside
CAS:2-Azidoethyl 2,3,4,6-tetra-O-acetyl-β-D-glucopyranosidePurezza:99% minColore e forma:White Solid-CrystallinePeso molecolare:417.37g/molAlosetron Hydrochloride
CAS:Formula:C17H18N4O·HClPurezza:>98.0%(HPLC)Colore e forma:White to Light yellow powder to crystalPeso molecolare:330.82LOC653428 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653428 antibody, catalog no. 70R-9057D(-)-Aspartic acid, +99%
CAS:This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.Formula:C4H7NO4Purezza:99%Colore e forma:Crystalline powder, White to off-whitePeso molecolare:133.101-Pyrrolidinecarboxylic acid, 2-(aminocarbonyl)-, phenylmethyl ester,(2S)-
CAS:Formula:C13H16N2O3Purezza:95%Colore e forma:SolidPeso molecolare:248.2777RHBG antibody
RHBG antibody was raised using a synthetic peptide corresponding to a region with amino acids RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQRPurezza:Min. 95%
