CymitQuimica logo

PRKRA antibody

Ref. 3D-70R-5896

1u
Discontinued
100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

PRKRA antibody
Biosynth

Product Information

Name:PRKRA antibody
Brand:Biosynth
Description:PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Purity:Min. 95%

Inquiry about discontinued product: PRKRA antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.