Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas
- Por Alvo Biológico
- Por uso/Efeitos Farmacológicos
- Compostos relacionados à criopreservação e aos crioconservantes
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados
- Hormónios
- Biologia Vegetal
- Metabólitos secundários
Produtos da "Bioquímicos e reagentes"
Ordenar por
CHST1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CHST1 antibody, catalog no. 70R-7237Pureza:Min. 95%(Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt
CAS:Please enquire for more information about (Pyr 3)-Amyloid b-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C187H283N51O53SPureza:Min. 95%Peso molecular:4,125.63 g/mol5,10,15,20-Tetrakis(3,5-dihydroxyphenyl)porphyrin
CAS:Fórmula:C44H30N4O8Pureza:>90.0%(HPLC)Cor e Forma:Dark red to Dark purple to Dark blue powder to crystalPeso molecular:742.74CCL15 protein
22-113 amino acids: MQFINDAETE LMMSKLPLEN PVVLNSFHFA ADCCTSYISQ SIPCSLMKSY FETSSECSKP GVIFLTKKGR QVCAKPSGPG VQDCMKKLKP YSIPureza:Min. 95%CRP antibody
The CRP antibody is a highly effective monoclonal antibody that targets C-reactive protein (CRP). This antibody has been extensively studied and proven to inhibit the activity of CRP, which plays a crucial role in inflammation and immune response. By binding to CRP, this antibody prevents its interaction with other molecules and inhibits its phosphatase activity. In addition to its cytotoxic effects on cells expressing high levels of CRP, the CRP antibody has also been shown to modulate the production of granulocyte-macrophage colony-stimulating factor (GM-CSF), a key growth factor involved in immune cell development. This modulation can have significant implications for various diseases and conditions related to abnormal immune responses. Furthermore, the CRP antibody has demonstrated an affinity for calmodulin, a calcium-binding protein found in human serum. This interaction enhances the stability and specificity of the antibody, making it an ideal tool for research and diagnostic applications. With its exceptional performance and specificity, thisRab27b Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Rab27b antibody, catalog no. 70R-9411Pureza:Min. 95%H-GLFDIIKKIAESFC-OH
H-GLFDIIKKIAESFC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLFDIIKKIAESFC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLFDIIKKIAESFC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLFDIIKKIAESFC-OH at the technical inquiry form on this pagePureza:Min. 95%β-D-Glucopyranoside, 3-hydroxy-5-[(1E)-2-(3-hydroxy-4-methoxyphenyl)ethenyl]phenyl
CAS:Fórmula:C21H24O9Pureza:98%Cor e Forma:SolidPeso molecular:420.4099H-MPDP-OH
H-MPDP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MPDP-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MPDP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MPDP-OH at the technical inquiry form on this pagePureza:Min. 95%Cyclin B1 antibody
Cyclin B1 antibody was raised using the middle region of CCNB1 corresponding to a region with amino acids AKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKVPureza:Min. 95%JTE 952
CAS:Inhibitor of colony stimulating factor receptor CSF-1RFórmula:C30H34N2O6Pureza:Min. 95%Peso molecular:518.6 g/molARF6 antibody
The ARF6 antibody is a cation that belongs to the group of polyclonal antibodies. It is derived from human serum albumin and is commonly used in life sciences research. This antibody specifically targets the epidermal growth factor (EGF) and has neutralizing properties against this growth factor. The ARF6 antibody can be used in various immunoassays to detect and quantify EGF-like molecules, such as chemokines, in biological samples. Its high affinity for human serum albumin ensures optimal binding and detection sensitivity. Researchers rely on the ARF6 antibody to accurately measure the levels of EGF and related molecules in their experiments.
![β-D-Glucopyranoside, 3-hydroxy-5-[(1E)-2-(3-hydroxy-4-methoxyphenyl)ethenyl]phenyl](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FIN%2Fthumb-webp%2FDA001NJL.webp&w=3840&q=75)
