Bioquímicos e reagentes

Azido-dPEG®8-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, Aazido-dPEG®8-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

White's basal salt mixture

Cariprazine hydrochloride is an antipsychotic drug that belongs to the class of drugs called dopamine receptor antagonists. Cariprazine binds to dopamine receptors in the brain, blocking the effects of dopamine and thereby reducing psychotic symptoms. Cariprazine has been shown to be effective for the treatment of schizophrenia and bipolar disorder in clinical trials. In addition, it has a matrix effect on symptoms that are resistant to other antipsychotic medications. Cariprazine also has pharmacological properties that make it a suitable candidate for drug interactions with other psychotropic medications such as benzodiazepines, antidepressants, opioids, or anticonvulsants.

Peptide Ac-QEPEPPEPFEYIDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-QEPEPPEPFEYIDD-NH2 include the following: Structure of the Rpn13-Rpn2 complex provides insights for Rpn13 and Uch37 as anticancer targets X Lu , U Nowicka , V Sridharan , F Liu, L Randles - Nature , 2017 - nature.comhttps://www.nature.com/articles/ncomms15540

TOR2A antibody was raised using the N terminal of TOR2A corresponding to a region with amino acids GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS

H-VIKQPCPKISFDPIP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VIKQPCPKISFDPIP-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VIKQPCPKISFDPIP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VIKQPCPKISFDPIP-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of RIT1 antibody, catalog no. 70R-10367

Recombinant Human MAPK8 protein with His tag

Recombinant human NAE1 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of TOP2B antibody, catalog no. 70R-8235

Purified Polyclonal CBP86 antibody

Mouse monoclonal CP15 antibody

FSCN1 antibody was raised in Rabbit using Human FSCN1 as the immunogen

H-YDFAFRDL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YDFAFRDL-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YDFAFRDL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YDFAFRDL-OH at the technical inquiry form on this page

Peptide H-ILLAELEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ILLAELEQLK^-OH include the following: Multiple reaction monitoring-based targeted assays for the validation of protein biomarkers in brain tumors S Ghantasala , MGJ Pai , D Biswas , N Gahoi - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2021.548243/full Sumoylation of vimentin354 is associated with PIAS3 inhibition of glioma cell migration L Wang, J Zhang, S Banerjee, L Barnes, V Sajja, Y Liu - Oncotarget, 2010 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC3248133/ Differential proteomics of lesional vs. non-lesional biopsies revealed non-immune mechanisms of alopecia areata K Thanomkitti , R Kanlaya, K Fong-Ngern - Scientific Reports, 2018 - nature.comhttps://www.nature.com/articles/s41598-017-18282-1 Dynamics of absolute amount of nephrin in a single podocyte in puromycin aminonucleoside nephrosis rats calculated by quantitative glomerular proteomics H Kawakami, J Kamiie, K Yasuno - Nephrology Dialysis , 2012 - academic.oup.comhttps://academic.oup.com/ndt/article-abstract/27/4/1324/1832322

Kv and SK channels blocker

Purified recombinant NAA10 protein

Affinity purified Rabbit polyclonal CD34 antibody

Mouse monoclonal LENG1 antibody

PAX6 antibody was raised in mouse using recombinant Paired Box Gene 6 (Aniridia, Keratitis)

2,2,2-trichloroethoxysulfonyl chloride

This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.This peptide contains Sulfocyanine5, which is a fluorescent red dye.

Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) whole molecule as the immunogen.

Rabbit polyclonal ARHGEF18 antibody (FITC)

H1FOO antibody was raised using the middle region of H1FOO corresponding to a region with amino acids KAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASS

Please enquire for more information about Gram Positive Bacteria Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Goat anti-Bovine IgG (H + L) (FITC) was raised in goat using purified Bovine IgG (H&L) as the immunogen.

Selamectin is a medicinal compound that acts as an inhibitor of protein kinases. It has been found to be effective in the treatment of tumors and cancer cells. Selamectin is an analog of other anticancer protein kinase inhibitors, and it has been shown to induce apoptosis in cancer cells. This compound has also been found to be effective against Chinese hamster ovary cells and human urine-derived cell lines. Selamectin works by inhibiting specific kinases that are involved in the growth and survival of cancer cells, making it a promising candidate for future cancer treatments.

A synthetic peptide for use as a blocking control in assays to test for specificity of FGR antibody, catalog no. 70R-3655

H-EYEERESEFDIEDE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EYEERESEFDIEDE-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EYEERESEFDIEDE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EYEERESEFDIEDE-OH at the technical inquiry form on this page

FMNL1 antibody was raised in Rabbit using Human FMNL1 as the immunogen

Cefuracetam is a beta-lactamase inhibitor that inhibits the activity of β-lactamases, which are enzymes that break down and inactivate penicillins. It is used to treat infections caused by resistant bacteria such as Pseudomonas aeruginosa. Cefuracetam is administered orally or topically for the treatment of ophthalmic diseases, such as bacterial conjunctivitis, and inflammatory diseases such as rheumatoid arthritis. The drug has been shown to inhibit fatty acid synthesis and bile acid formation in rats. Cefuracetam can be administered orally or topically for the treatment of ophthalmic diseases, such as bacterial conjunctivitis, and inflammatory diseases such as rheumatoid arthritis. The drug has been shown to inhibit fatty acid synthesis and bile acid formation in rats.

Polyclonal Bacillus anthracis antibody (Lethal Factor), Anti-Bacillus anthracis antibody (Lethal Factor), Bacillus anthracis LF antibody, Anthrax LF antibody, Bacillus anthracis Lethal Factor antibody, Anthrax Lethal Factor antibody

H-IMIVGGLIGLRIVFA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IMIVGGLIGLRIVFA-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IMIVGGLIGLRIVFA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IMIVGGLIGLRIVFA-OH at the technical inquiry form on this page

Rabbit polyclonal PEA15 antibody

Rabbit polyclonal SES1 antibody

Peptide H-GIINTLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GIINTLQK^-OH include the following: Egyetemi doktori (PhD) ertekezes tezisei MSaca‰SID ISKOLA - dea.lib.unideb.huhttps://dea.lib.unideb.hu/bitstreams/bd058c28-a2bf-47d1-b8ac-a8e65fa0f702/download Relative quantification of human beta-defensins by a proteomics approach based on selected reaction monitoring G Kallo , A Chatterjee, M Toth - Rapid , 2015 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.7259 THESIS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY (PHD) G Kallo - dea.lib.unideb.huhttps://dea.lib.unideb.hu/bitstreams/b159686e-fcbd-48df-b0f2-e2328ad19e8d/download

Anti Pancreastatin (33-51) (Rat) Serum is a high purity, potent inhibitor of pancreatic secretions. This product is a peptide that inhibits the secretion of pancreatic enzymes by competitive inhibition of the pancreatic proenzyme, trypsinogen. It has been used in pharmacological research as a tool for studying protein interactions and receptor binding. Anti Pancreastatin (33-51) (Rat) Serum has also been shown to have anti-inflammatory properties.

HTR7 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Please enquire for more information about H-2kb tetramer peptide - OVA including the price, delivery time and more detailed product information at the technical inquiry form on this page

FN3K antibody was raised in Rabbit using Human FN3K as the immunogen