Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP21A2 antibody, catalog no. 70R-9997

TOMM40L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD

H-IRFRFDGQPI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IRFRFDGQPI-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IRFRFDGQPI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IRFRFDGQPI-OH at the technical inquiry form on this page

KLC1 antibody was raised in Rabbit using Human KLC1 as the immunogen

Purified Polyclonal Tetraspanin 8 antibody

Rabbit polyclonal POTED antibody

ELISA Kit for detection of E2 in the research laboratory

Rabbit polyclonal HDAC6 antibody

This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF597 antibody, catalog no. 70R-8130

The immunoglobulin IgE, is produced by plasma cells in response to antigenic stimuli. Measurement of total serum IgE is often used as a tool in the diagnosis and management of atopic diseases such as asthma, hay fever, atopic dermatitis and urticaria. It has been used to distinguish atopic from non-atopic individuals presenting allergy-like symptoms. In addition, studies have also shown that increased levels of IgE in cord blood and infants may be predictive of future atopic tendencies. Normal levels of circulating IgE are extremely low in comparison to other immunoglobulins. Levels of IgE at birth are almost undetectable but increase in non-allergic adults. Elevated levels are commonly seen in cases of allergic diseases, parasitic infections, pulmonary aspergillosis, Wiskott-Aldrich syndrome, and myeloma. Myeloma IgE serum has been the raw material of choice for many years for manufacturers of IgE control and calibrators. Locating this natural product can be challenging and often companies are forced to hold large volumes in stock or face potential out of stock situation. Compared to native myeloma plasma, this IgE cell culture derived product has the distinct advantage of always being available. The material is derived from a human myeloma cell line which means that lot to lot consistency is guaranteed without having to worry about relying on a donor and all of the concerns that can accompany a natural product.

Orchid seed sowing medium

Rabbit polyclonal EGFR antibody

Mouse monoclonal MGLL antibody

Ac-RGREAAPTQPRVRC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-RGREAAPTQPRVRC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-RGREAAPTQPRVRC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-RGREAAPTQPRVRC-NH2 at the technical inquiry form on this page

Creatine Kinase MB (CK-MB), Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Creatine Kinase MB (CK-MB), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Please enquire for more information about β-Defensin-1, human including the price, delivery time and more detailed product information at the technical inquiry form on this page

Posenacaftor is a small molecule that belongs to the class of peptide inhibitors. It inhibits Protein interactions and is an activator of the ATP-binding cassette transporter A1 (ABCA1). Posenacaftor is used as a research tool to study the role of ABCA1 in lipid metabolism, as well as to study other proteins and their ligands. This drug has been shown to inhibit the activity of ion channels, which may have implications for treatment of epilepsy. Posenacaftor also binds to receptor sites on cells and blocks them, preventing calcium from entering into cells. This process leads to decreased inflammation and muscle contraction.