Biochemicals and Reagents

PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

D-JNKI-1 is a synthetic peptide inhibitor, specifically targeting the c-Jun N-terminal kinase (JNK) pathway. It is developed from a human-derived sequence, incorporating a D-enantiomer configuration to enhance stability and resistance to proteolytic degradation. The mode of action involves the competitive inhibition of JNK's interaction with its substrates, effectively blocking the phosphorylation and subsequent activation of downstream targets. This inhibitory mechanism is achieved by binding directly to the JNK protein, preventing it from executing its usual signaling responsibilities. D-JNKI-1 is primarily utilized in neurological research applications where JNK signaling plays a crucial role, such as in studies of neurodegenerative diseases, ischemic brain injury, and neuronal apoptosis. Its ability to cross the blood-brain barrier enhances its utility in central nervous system investigations. Researchers employ D-JNKI-1 in in vitro and in vivo models to dissect JNK-mediated pathways and evaluate potential therapeutic strategies in disease-modifying research. By modulating the JNK signal transduction cascade, D-JNKI-1 provides a valuable tool for elucidating the molecular underpinnings of JNK-related pathologies and exploring potential interventions.

Peptide H-DIDEVSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DIDEVSSLLR-OH include the following: DELL'ANEMIA DI DIAMOND-BLACKFAN M ARMIRAGLIO - med.unipmn.ithttps://www3.med.unipmn.it/Dottorato/Medicina_Molecolare/tesi-2009/Sessione_II/Tesi_Marta_Armiraglio.pdf

Rabbit polyclonal Keratin 19 antibody

Purified Polyclonal Cytokeratin 16 antibody

5-Cyano-2,3-ditolyl tetrazolium chloride

Peptide H-RPQVPLRPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RPQVPLRPM-OH include the following: Immunological Control of HIV-1 Disease Progression by Rare Protective HLA Allele Y Zhang, T Chikata, N Kuse, H Murakoshi - Journal of , 2022 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/jvi.01248-22 A molecular switch in immunodominant HIV-1-specific CD8 T-cell epitopes shapes differential HLA-restricted escape HN Kloverpris , DK Cole , A Fuller, J Carlson , K Beck - Retrovirology, 2015 - Springerhttps://link.springer.com/article/10.1186/s12977-015-0149-5 Impact of intrinsic cooperative thermodynamics of peptide-MHC complexes on antiviral activity of HIV-specific CTL C Motozono, S Yanaka , K Tsumoto - The Journal of , 2009 - journals.aai.orghttps://journals.aai.org/jimmunol/article/182/9/5528/103985 Cross-reactivity analysis of T cell receptors specific for overlapping HIV-1 Nef epitopes of different lengths C Motozono, M Yokoyama, H Sato, T Ueno - Microbes and Infection, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1286457913002669 Cell activation-based screening of natively paired human T cell receptor repertoires AS Fahad , CY Chung , SN Lopez Acevedo, N Boyle - Scientific reports, 2023 - nature.comhttps://www.nature.com/articles/s41598-023-31858-4 Activation-Based Co-Culture Screening of Natively Paired Human T Cell Receptor Libraries AS Fahad - Immune Repertoires, 2021 - search.proquest.comhttps://search.proquest.com/openview/a9b2af676126ccee9daea41532781eaf/1.pdf?pq-origsite=gscholar&cbl=18750&diss=y#page=116

Putrescine, free base

Mouse monoclonal SH2B3 antibody

Eotaxin 3 antibody was raised in mouse using highly pure recombinant human eotaxin-3 as the immunogen.

Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of TOP2B antibody, catalog no. 70R-7968

Rabbit polyclonal RPN2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-9635

A synthetic peptide for use as a blocking control in assays to test for specificity of TLR8 antibody, catalog no. 70R-9660

DHDH antibody was raised in Rabbit using Human DHDH as the immunogen

H-CDPKKVHPGSSVEGD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CDPKKVHPGSSVEGD-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CDPKKVHPGSSVEGD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CDPKKVHPGSSVEGD-OH at the technical inquiry form on this page

Involved in the metabolism of fatty acids and amino acids