Biochemicals and Reagents

Bis(sulphosuccinimidyl)suberate

ELISA kit for the detection of Rheumatoid Factor screen IgG/IgM/IgA in the research laboratory

Recombinant human SUMF1 protein (His tag)

Rabbit polyclonal Radixin antibody (Thr558)

H-NRKKPAILRRNIHSL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NRKKPAILRRNIHSL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NRKKPAILRRNIHSL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NRKKPAILRRNIHSL-OH at the technical inquiry form on this page

GMC 2-29 is a broad-spectrum fungicide, which is derived from chemical synthesis with systemic properties. As a product of chemico-biological research, it is engineered to inhibit fungal growth by interfering with essential cellular processes within target pathogens. Its active ingredients penetrate plant tissues, providing efficient internal protection against a range of fungal diseases. This fungicide is used principally in agricultural practices, particularly in the cultivation of crops vulnerable to fungal infections. By integrating GMC 2-29 into crop management regimens, it plays a pivotal role in maintaining plant health and ensuring higher yields. The systemic nature ensures that the active compounds are transported throughout the plant, thus offering comprehensive defense and reducing the need for frequent applications. Additionally, its formulation allows it to remain effective across various environmental conditions, making it a versatile tool in integrated pest management strategies.

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6152

AMG 337 is a small molecule inhibitor, which is derived from synthetic chemical processes, with a mode of action involving the selective inhibition of the c-Met receptor tyrosine kinase. The c-Met receptor, also known as hepatocyte growth factor receptor, plays a critical role in various cellular processes such as proliferation, survival, and motility. Dysregulation of c-Met signaling is implicated in several types of cancers, making it a significant therapeutic target. This inhibitor competitively binds to the ATP-binding site of the c-Met receptor, thus preventing its autophosphorylation and subsequent activation of downstream signaling pathways. By inhibiting these pathways, AMG 337 can impede the growth and spread of tumor cells that are reliant on aberrant c-Met signaling. AMG 337 has been primarily studied for its applications in the treatment of cancers, such as gastric and esophageal cancers, where c-Met overexpression or mutation is observed. Research has explored its efficacy in both monotherapy and in combination with other therapeutic agents, aiming to enhance anti-tumor activity. As a potent inhibitor of c-Met, AMG 337 offers a promising therapeutic strategy for targeting malignancies driven by this receptor.

C14orf48 antibody was raised in rabbit using the N terminal of C14orf48 as the immunogen

Mycophenolate mofetil

A synthetic peptide for use as a blocking control in assays to test for specificity of FEM1B antibody, catalog no. 70R-6027

ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND

Mal-amido-PEG12-acid

Rabbit Polyclonal IRS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC59 antibody, catalog no. 70R-6890

AUH antibody was raised in Rabbit using Human AUH as the immunogen