Biochemicals and Reagents

AFM antibody was raised in rabbit using the C terminal of AFM as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP21A2 antibody, catalog no. 70R-9997

Lamin A/C Monoclonal Antibody

CPNE6 antibody was raised in Rabbit using Human CPNE6 as the immunogen

Norovirus GII.4 VLP, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Norovirus GII.4 VLP, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.

5,5'-(Piperazine-1,4-diylbis(1-hydroxyethane-2,1-diyl))bis(4-methylisobenzofuran-1(3H)-one) is a hygroscopic white powder that has been used as an antihypertensive agent. This compound is structurally closely related to the pyrazolopyrimidine class of antihypertensive agents. 5,5'-(Piperazine-1,4-diylbis(1-hydroxyethane-2,1-diyl))bis(4-methylisobenzofuran-1(3H)-one) also has antiviral and antimalarial activities.

GPR61 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

m-dPEG®24-DSPE is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-DSPE is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

CLDN18 antibody was raised in Rabbit using Human CLDN18 as the immunogen

Mouse monoclonal PDIA4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ESR1 antibody, catalog no. 70R-5681

H-His(Trt)-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for peptide synthesis. It contains thiols, building blocks, alcohols, amines, and other functional groups. The resin is used as a building block in the synthesis of peptides.

SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF

MRPL12 antibody was raised in Rabbit using Human MRPL12 as the immunogen

Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-G^P-OH include the following: Gaussian process: a promising approach for the modeling and prediction of peptide binding affinity to MHC proteins Y Ren, X Chen, M Feng, Q Wang - Protein and peptide , 2011 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ppl/2011/00000018/00000007/art00004 Characterization of the binding profile of peptide to transporter associated with antigen processing (TAP) using Gaussian process regression Y Ren, B Wu, Y Pan, F Lv, X Kong, X Luo, Y Li - Computers in biology , 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0010482511001521 Delta-peptide is the carboxy-terminal cleavage fragment of the nonstructural small glycoprotein sGP of Ebola virus VA Volchkova, HD Klenk, VE Volchkov - Virology, 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S004268229990034X A defined peptide that inhibits the formation of the glycoprotein IIb and IIIa complex TM Chiang, J Zhu - Thrombosis research, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0049384804005924 Triflavin, an antiplatelet Arg-Gly-Asp-containing peptide, is a specific antagonist of platelet membrane glycoprotein IIb-IIIa complex TF Huang, JR Sheu, CM Teng - The Journal of , 1991 - academic.oup.comhttps://academic.oup.com/jb/article-abstract/109/2/328/1032286 Evaluation of interaction forces between profilin and designed peptide probes by atomic force microscopy T Okada, M Sano, Y Yamamoto, H Muramatsu - Langmuir, 2008 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/la703344u Identification of Lassa virus glycoprotein signal peptide as a trans-acting maturation factor R Eichler, O Lenz, T Strecker, M Eickmann - EMBO , 2003 - embopress.orghttps://www.embopress.org/doi/abs/10.1038/sj.embor.7400002 Modeling and prediction of binding affinities between the human amphiphysin SH3 domain and its peptide ligands using genetic algorithm-Gaussian processes P Zhou , F Tian, X Chen, Z Shang - Peptide Science, 2008 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bip.21091 Binding peptide-promoted biofunctionalization of graphene paper with hydroxyapatite for stimulating osteogenic differentiation of mesenchymal stem cells M Wang, T Yang , Q Bao , M Yang - ACS Applied Materials & , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acsami.1c20740 Immuno-affinity purification of specific antibodies against human gastrin releasing peptide (h-GRP) by the h-GRP (1-8)-linked poly dimethylacrylamide resin M TAKEYAMA, T KINO, L GUO - Journal of Peptide , 1989 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1989.tb00223.x Synthesis, evaluation and Tc-99m complexation of a hydrazinonicotinyl conjugate of a GP IIb/IIIa antagonist cyclic peptide for the detection of deep vein thrombosis M Rajopadhye, TD Harris, K Yu, D Glowacka - Bioorganic & Medicinal , 1997 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0960894X97000838 Proline-containing peptides-New insight and implications: A Review M Misiura, W Miltyk - Biofactors, 2019 - Wiley Online Libraryhttps://iubmb.onlinelibrary.wiley.com/doi/abs/10.1002/biof.1554 Dipeptidyl peptidase IV inhibitory peptides generated in Spanish dry-cured ham M Gallego, MC Aristoy, F Toldra - Meat science, 2014 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0309174013005329 Synthetic peptides derived from fibrinogen and fibronectin change the conformation of purified platelet glycoprotein IIb-IIIa. LV Parise, SL Helgerson, B Steiner, L Nannizzi - Journal of Biological , 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818452477 Triflavin, an Arg-Gly-Asp-containing Peptide, Inhibits Tumor Cell-induced Platelet Aggregation JR Sheu, CH Lin, HC Peng, CM Teng - Japanese journal of , 1993 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1349-7006.1993.tb02802.x Complex of a protective antibody with its ebola virus GP peptide epitope: Unusual features of a Vλx light chain JE Lee, A Kuehne, DM Abelson, ML Fusco - Journal of molecular , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283607013393 Arginine-glycine-aspartic acid-and fibrinogen gamma-chain carboxyterminal peptides inhibit platelet adherence to arterial subendothelium at high wall shear rates. An JB Lawrence, WS Kramer, LP McKeown - The Journal of , 1990 - Am Soc Clin Investighttps://www.jci.org/articles/view/114896 Natural and hybrid ("œchimeric") stable regulatory glyproline peptides IP Ashmarin, GE Samonina, LA Lyapina, AA Kamenskii - Pathophysiology, 2005 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0928468004001051 Inhibition of fibrinogen binding to GP IIb-IIIa by a GP IIIa peptide IF Charo, L Nannizzi, DR Phillips, MA Hsu - Journal of Biological , 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818523103 Discovery of an orally active non-peptide fibrinogen receptor antagonist based on the hydantoin scaffold HU Stilz, W Guba, B Jablonka, M Just - Journal of medicinal , 2001 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jm001068s From a peptide lead to an orally active peptidomimetic fibrinogen receptor antagonist HU Stilz, W Guba, B Jablonka, M Just, O Klingler - Letters in Peptide , 1998 - Springerhttps://link.springer.com/article/10.1023/A:1008849013123 FRET-GP-A Local Measure of the Impact of Transmembrane Peptide on Lipids GCN Thakur , A Uday, P Jurkiewicz - Langmuir, 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.langmuir.3c02505 Glyproline peptide family: review on bioactivity and possible origins G Samonina, I Ashmarin, L Lyapina - Pathophysiology, 2002 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0928468002000184 The disulfide-rich region of platelet glycoprotein (GP) IIIa contains hydrophilic peptide sequences that bind anti-GPIIIa autoantibodies from patients with immune DJS Beardsley, C Tang, BG Chen, C Lamborn - Biophysical , 2003 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S030146220300111X Peptide kinetics. Part 3.-Acid catalysed hydrolysis of glycyl-glycyl-phenylalanine DA Long, TG Truscott - Transactions of the Faraday Society, 1963 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlepdf/1963/tf/tf9635901833 Ca2+-dependent binding of a synthetic Arg-Gly-Asp (RGD) peptide to a single site on the purified platelet glycoprotein IIb-IIIa complex B Steiner, D Cousot, A Trzeciak, D Gillessen - Journal of Biological , 1989 - ASBMBhttps://www.jbc.org/article/S0021-9258(18)51601-X/abstract Efficiency of erythropoietin's signal peptide for HIVMN-1 gp 120 expression AM Herrera, A Musacchio, JR Fernandez - Biochemical and , 2000 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X00929747

MDM4 antibody was raised in Mouse using a purified recombinant fragment of human MDM4 expressed in E. coli as the immunogen.

Cytokeratin 18 protein is a vital component of the cytoskeleton in epithelial cells. It is commonly used as a biomarker for the detection and diagnosis of various types of cancers, including breast, lung, and liver cancer. Monoclonal antibodies specific to cytokeratin 18 protein are widely used in research and diagnostic assays to detect its presence in tissues or body fluids. These antibodies can be used in immunohistochemistry, western blotting, or ELISA assays to accurately quantify cytokeratin 18 protein levels. The recombinant form of cytokeratin 18 protein is produced using advanced biotechnology techniques and exhibits high purity and biological activity. It can be used as a positive control in experiments or as a standard for calibration curves. Cytokeratin 18 protein is also utilized in the development of new therapeutic drugs or inhibitors targeting cancer cells that express high levels of this protein. In addition to its role in cancer research, cytokeratin 18 protein