Biochemicals and Reagents

Peptide H-NQNTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-NQNTFLR^-OH include the following: Mapping the eosinophil cationic protein antimicrobial activity by chemical and enzymatic cleavage D Sanchez, M Moussaoui, E Carreras, M Torrent - Biochimie, 2011 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0300908410003652

H-LGPRGHLHLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LGPRGHLHLR-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LGPRGHLHLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LGPRGHLHLR-OH at the technical inquiry form on this page

APOL2 antibody was raised in rabbit using the middle region of APOL2 as the immunogen

Rat monoclonal IgM Isotype Control Fc fusion protein (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of Mapk9 antibody, catalog no. 70R-9534

Mouse sequence expressed in NS0 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

Catalogue peptide; min. 95% purity

Sirt2-in-1 is a research tool used for the study of protein interactions. This chemical is used for ligand binding and receptor activation studies. It is also used to study the function of ion channels, cells, and other proteins. Sirt2-in-1 has high purity and can be used in a variety of applications including pharmacology, cell biology, and biochemistry.

A synthetic peptide for use as a blocking control in assays to test for specificity of IARS antibody, catalog no. 70R-3179

Human monoclonal antibody targeting VEGFR2; developed for solid tumor treatment

SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

H-ILKDPVHGVYYDPAK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ILKDPVHGVYYDPAK-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ILKDPVHGVYYDPAK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ILKDPVHGVYYDPAK-OH at the technical inquiry form on this page

Purified Polyclonal PDGFR beta antibody

Peptide H-AATVGSLAGQPLQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-AATVGSLAGQPLQER-OH include the following: Glyco-DIA: a method for quantitative O-glycoproteomics with in silico-boosted glycopeptide libraries Z Ye , Y Mao , H Clausen , SY Vakhrushev - Nature methods, 2019 - nature.comhttps://www.nature.com/articles/s41592-019-0504-x Isotopic N, N-dimethyl leucine tags for absolute quantification of clusterin and apolipoprotein E in Alzheimer's disease Y Liu , H Zhang , X Zhong , Z Li , H Zetterberg , L Li - Journal of proteomics, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1874391922000306 A strategy for discovery and verification of candidate biomarkers in cerebrospinal fluid of preclinical Alzheimer's disease X Zhong , J Wang, C Carlsson, O Okonkwo - Frontiers in molecular , 2019 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fnmol.2018.00483/full Advancing Mass Spectrometry-Based Discovery and Targeted Approaches for Disease Proteomic and PTM Analyses X Zhong - 2019 - search.proquest.comhttps://search.proquest.com/openview/a78fd8fc14f9808aa5ff581f050979c9/1?pq-origsite=gscholar&cbl=18750&diss=y A high throughput, multiplexed and targeted proteomic CSF assay to quantify neurodegenerative biomarkers and apolipoprotein E isoforms status WE Heywood , A Baud, E Bliss, E Sirka - JoVE (Journal of , 2016 - jove.comhttps://www.jove.com/t/54541/a-high-throughput-multiplexed-targeted-proteomic-csf-assay-to O-glycosylation on cerebrospinal fluid and plasma apolipoprotein E differs in the lipid-binding domain SA Flowers , OC Grant , RJ Woods , GW Rebeck - Glycobiology, 2020 - academic.oup.comhttps://academic.oup.com/glycob/article-abstract/30/2/74/5585506 Multiple reaction monitoring-based targeted assays for the validation of protein biomarkers in brain tumors S Ghantasala , MGJ Pai , D Biswas , N Gahoi - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2021.548243/full Apolipoprotein E O-glycosylation is associated with amyloid plaques and APOE genotype PE Lawler, JG Bollinger, SE Schindler , CR Hodge - Analytical , 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0003269723001215 Quantification of total apolipoprotein E and its specific isoforms in cerebrospinal fluid and blood in Alzheimer's disease and other neurodegenerative diseases M Rezeli , H Zetterberg , K Blennow, A Brinkmalm - EuPA Open , 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2212968515300143 EuPA Open Proteomics M Rezeli , H Zetterberg , K Blennow, A Brinkmalm - cyberleninka.orghttps://cyberleninka.org/article/n/135520.pdf Increased APOE glycosylation plays a key role in the atherogenicity of L5 low-density lipoprotein LY Ke , HC Chan , CC Chen , CF Chang - The FASEB , 2020 - Wiley Online Libraryhttps://faseb.onlinelibrary.wiley.com/doi/abs/10.1096/fj.202000659R Proteomic analysis of human very low-density lipoprotein by two-dimensional gel electrophoresis and MALDI-TOF/TOF C Mancone, L Amicone, GM Fimia , E Bravo - , 2007 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200600339

HBsAg antibody was raised in goat using subtypes ad & ay as the immunogen.

Rabbit polyclonal CADM1 antibody

TMPRSS4 (199-207) fluorogenic peptide