Biochemicals and Reagents

Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin is a high purity, ion channel ligand that is used in research as a pharmacological tool. It is an activator of Kv1.3 channels and inhibits the function of Kv1.2 channels. This product can be used for the study of protein interactions and receptor pharmacology. Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin also has been found to inhibit the binding of antibodies to cells and can be used for immunoprecipitation experiments. This product has CAS number 188476-46-4 and is available in 1 g and 5 g sizes.

Peptide H-VTSIQDWVQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VTSIQDWVQK-OH include the following: Differentially expressed haptoglobin as a potential biomarker for type 2 diabetic mellitus in Hispanic population Z Liu , D Feng , D Gu, R Zheng, C Esperat, W Gao - BioFactors, 2017 - Wiley Online Libraryhttps://iubmb.onlinelibrary.wiley.com/doi/abs/10.1002/biof.1352 Serum proteomic biomarkers diagnostic of knee osteoarthritis VB Kraus , A Reed, EJ Soderblom, YM Golightly - Osteoarthritis and , 2024 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1063458423009202 Assessment of the influence of the patient's inflammatory state on the accuracy of a haptoglobin selected reaction monitoring assay O Lassout, D Hochstrasser, P Lescuyer - Clinical proteomics, 2014 - Springerhttps://link.springer.com/article/10.1186/1559-0275-11-38 Urine haptoglobin levels predict early renal functional decline in patients with type 2 diabetes NM Bhensdadia, KJ Hunt, MF Lopes-Virella - Kidney international, 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0085253815558869 Quantitation of 87 proteins by nLC-MRM/MS in human plasma: workflow for large-scale analysis of biobank samples M Rezeli , K Sjödin, H Lindberg - Journal of proteome , 2017 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.7b00235 Diagnostic protein discovery using liquid chromatography/mass spectrometry for proteolytic peptide targeting JM Koomen , H Zhao, D Li , W Nasser - Journal Devoted to , 2005 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/rcm.1963 A proteogenomic analysis of haptoglobin in malaria G Awasthi , S Tyagi , V Kumar , SK Patel - PROTEOMICS , 2018 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/prca.201700077

Peptide H-RLLVPTQFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RLLVPTQFV-OH include the following: Peptides derived from human insulin-like growth factor-II mRNA binding protein 3 can induce human leukocyte antigen-A2-restricted cytotoxic T lymphocytes reactive Y Tomita, M Harao, S Senju, K Imai, S Hirata - Cancer , 2011 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1349-7006.2010.01780.x

Purified recombinant PAFAH1B3 protein (His tag)

Rabbit polyclonal PRKRA antibody

CCT4 antibody was raised in Rabbit using Human CCT4 as the immunogen

Rabbit polyclonal MNK1 antibody (Thr255)

ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

3-(Boc-amino)piperidine is used as an organic chemical synthesis intermediate. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPV5 antibody, catalog no. 70R-5176

ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Amino-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

1-133 amino acids: MRAPIPEPKP GDLIEIFRPF YRHWAIYVGD GYVVHLAPPS EVAGAGAASV MSALTDKAIV KKELLYDVAG SDKYQVNNKH DDKYSPLPCS KIIQRAEELV GQEVLYKLTS ENCEHFVNEL RYGVARSDQV RDV

Selective blocker of muscular nACh receptors

Rabbit polyclonal OR10G4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RFP2 antibody, catalog no. 70R-8017

A synthetic peptide for use as a blocking control in assays to test for specificity of GNL3 antibody, catalog no. 70R-3045

Recombinant Human UBE2E3 protein with His tag