Biochemicals and Reagents

The HER2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of HER2, a growth factor receptor that plays a crucial role in cell proliferation and survival. This acidic antibody has shown cytotoxic effects against various cancer cells expressing high levels of HER2, making it a valuable tool in cancer research and therapy. The HER2 antibody works by binding to the HER2 receptor on the surface of cancer cells, preventing its activation and subsequent signaling pathways that promote tumor growth. By inhibiting the activity of HER2, this antibody effectively suppresses cell division and induces apoptosis, leading to the destruction of cancer cells. In addition to its anti-cancer properties, the HER2 antibody has also been found to have inhibitory effects on other receptors such as insulin and tyrosinase. This broadens its potential applications in various fields of research including diabetes and dermatology. Researchers have also discovered that this monoclonal antibody interacts

LPP antibody was raised in Mouse using a purified recombinant fragment of human LPP expressed in E. coli as the immunogen.

Please enquire for more information about Ethyl p-(6-bromohexyloxy)benzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Peptide H-KLVFFAEDVGSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KLVFFAEDVGSN-OH include the following: CNS amyloid-beta, soluble APP-alpha and-beta kinetics during BACE inhibition JA Dobrowolska , MS Michener, G Wu - Journal of , 2014 - Soc Neurosciencehttps://www.jneurosci.org/content/34/24/8336.short

O-6-Methylguanine-DNA Methyltransferase, human, recombinant is a recombinant protein that belongs to the class of proteins and enzymes. It is an enzyme that catalyzes the transfer of methyl groups from S-adenosylmethionine to guanine in DNA. The methylated guanines are recognized by proteins that bind to DNA and inhibit transcription. This enzyme has been shown to be important in the development of cancer cells, which may be due to its ability to inhibit DNA repair.

A synthetic peptide for use as a blocking control in assays to test for specificity of HP antibody, catalog no. 70R-5419

Rabbit polyclonal Septin 2 antibody

A4GALT antibody was raised using a synthetic peptide corresponding to a region with amino acids VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

A synthetic peptide for use as a blocking control in assays to test for specificity of LMF2 antibody, catalog no. 70R-6271

Zankiren is a peptide inhibitor of protein interactions. It has been shown to inhibit the activity of several proteins, including G-protein coupled receptors and ion channels. Zankiren is a high purity research tool that can be used for studying cell biology and pharmacology.

Mouse monoclonal PLEK antibody

Digitoxin antibody was raised in rabbit using digitoxin-BSA as the immunogen.

Rabbit polyclonal IKZF3 antibody

ELISA kit for the detection of Adiponectin in the research laboratory

AURKB antibody was raised in mouse using recombinant human Aurora kinase B (1-344aa) purified from E. Coli as the immunogen.

Mouse monoclonal Heat Stable Enterotoxin Monoclonal antibody

Anagrelide is a thrombocytopenic drug that is used to treat thrombocythemia and related conditions. This drug works by decreasing the platelet count by suppressing transcription factors that are necessary for the maturation of platelets. This drug is also a phosphodiesterase III inhibitor. Anagrelide HCl is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.

PKI (5-24) is a synthetic peptide specifically designed as a protein kinase inhibitor. Derived from a segment of the endogenous PKA inhibitor protein, this peptide is utilized to inhibit the activity of cyclic AMP-dependent protein kinase (PKA). The sequence corresponds to amino acids 5-24 of the native protein, retaining its potent inhibitory activity. PKI (5-24) functions by binding to the catalytic subunit of PKA, thus preventing the phosphorylation of downstream targets. In research settings, PKI (5-24) is applied to study PKA signaling pathways, ascertain the role of PKA in various cellular processes, and elucidate the impacts of PKA inhibition in different physiological contexts. It is particularly valuable in investigations into signal transduction, cell metabolism, and neurobiology, providing insights into mechanisms underlying disorders such as cancer and cardiovascular diseases. As an established tool in molecular biology and biochemistry, PKI (5-24) enables targeted modulation of kinase activity, thereby facilitating precise investigation of cellular signaling pathways.

The PDF antibody is a highly specialized molecule drug used in the field of Life Sciences. It is an activated antibody that acts as an anticoagulant, inhibiting the clotting process. This unique antibody has the ability to neutralize various molecules involved in blood coagulation, such as insulin, albumin, and fibrinogen. The PDF antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and exhibits high specificity for its target. In human serum, this antibody has shown remarkable efficacy in inhibiting protein kinase activity, making it a valuable tool for research and therapeutic applications in the field of Life Sciences.

This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.

Affinity purified Rabbit polyclonal DPRP1 antibody

Peptide H-FESSAAKLKRKYWWKNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FESSAAKLKRKYWWKNLK^-OH include the following: Purification and characterization of botulinum neurotoxin FA from a genetically modified Clostridium botulinum strain S Pellett, WH Tepp, M Bradshaw, SR Kalb, JK Dykes - Msphere, 2016 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/msphere.00100-15 Quantification of botulinum neurotoxin serotypes A and B from serum using mass spectrometry BA Parks, JD Shearer, J Baudys , SR Kalb - Analytical , 2011 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/ac201910q

Purified Polyclonal HIC2 antibody

Mouse monoclonal Rotavirus VP6 antibody

A Cholesterol Ester Transfer Protein (CETP) light tryptic peptide standard responsible for use in protein identification and quantitation studies. CETP is an enzyme which moves cholesterol esters from high density lipoproteins (HDL) to apolioprotein B-containing particles. This action lowers the amount of HDL which may increase the risk of the disease atherosclerosis.

Mouse monoclonal SSR1 antibody

Rabbit polyclonal PLXDC2 antibody

Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.

TC SL C5 is a monoclonal antibody that binds to the extracellular domain of human growth hormone receptor and inhibits its activity. The antibody is useful as a research tool in cell biology, pharmacology, and ligand-receptor interactions. TC SL C5 has been shown to inhibit the activation of human platelets by thrombin, which is mediated by the binding of thrombin to its receptor on platelets. TC SL C5 also inhibits the ionic current in rat brain cells, which may be due to its ability to bind to potassium channels.

Cutamesine is a sigma-1 agonist that was shown to upregulate the transcription of neurotrophic factors in vitro. It has been shown to increase levels of dopamine and acetylcholine, as well as reducing locomotor activity in rodents. Cutamesine also inhibits the mitochondrial membrane potential, which can help prevent neurodegenerative diseases such as Parkinson's Disease. In addition, cutamesine has been shown to have anti-inflammatory properties and may be an effective treatment for infectious diseases. Low-dose cutamesine was found to have no effect on cognition or memory in mice, making it a promising therapeutic option for older adults with cognitive impairment.

Human TGF-B1(Transforming Growth Factor Beta 1) ELISA Kit

A synthetic peptide for use as a blocking control in assays to test for specificity of IDH3A antibody, catalog no. 70R-3928

Anti-Human B7-H3 Monoclonal Antibody

Topoisomerase I inhibitor

It is used in heat-exchange media, metal polishes, and thinners for lacquers/varnishes. Also used to make para-cresol, carvacrol, and synthetic resins. It is also used as a component of commercial terpene solvent mixtures. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM5 antibody, catalog no. 70R-2852

Bis(sulphosuccinimidyl)suberate

ELISA kit for the detection of Rheumatoid Factor screen IgG/IgM/IgA in the research laboratory

Recombinant human SUMF1 protein (His tag)

Rabbit polyclonal Radixin antibody (Thr558)

H-NRKKPAILRRNIHSL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NRKKPAILRRNIHSL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NRKKPAILRRNIHSL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NRKKPAILRRNIHSL-OH at the technical inquiry form on this page

GMC 2-29 is a broad-spectrum fungicide, which is derived from chemical synthesis with systemic properties. As a product of chemico-biological research, it is engineered to inhibit fungal growth by interfering with essential cellular processes within target pathogens. Its active ingredients penetrate plant tissues, providing efficient internal protection against a range of fungal diseases. This fungicide is used principally in agricultural practices, particularly in the cultivation of crops vulnerable to fungal infections. By integrating GMC 2-29 into crop management regimens, it plays a pivotal role in maintaining plant health and ensuring higher yields. The systemic nature ensures that the active compounds are transported throughout the plant, thus offering comprehensive defense and reducing the need for frequent applications. Additionally, its formulation allows it to remain effective across various environmental conditions, making it a versatile tool in integrated pest management strategies.

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6152

AMG 337 is a small molecule inhibitor, which is derived from synthetic chemical processes, with a mode of action involving the selective inhibition of the c-Met receptor tyrosine kinase. The c-Met receptor, also known as hepatocyte growth factor receptor, plays a critical role in various cellular processes such as proliferation, survival, and motility. Dysregulation of c-Met signaling is implicated in several types of cancers, making it a significant therapeutic target. This inhibitor competitively binds to the ATP-binding site of the c-Met receptor, thus preventing its autophosphorylation and subsequent activation of downstream signaling pathways. By inhibiting these pathways, AMG 337 can impede the growth and spread of tumor cells that are reliant on aberrant c-Met signaling. AMG 337 has been primarily studied for its applications in the treatment of cancers, such as gastric and esophageal cancers, where c-Met overexpression or mutation is observed. Research has explored its efficacy in both monotherapy and in combination with other therapeutic agents, aiming to enhance anti-tumor activity. As a potent inhibitor of c-Met, AMG 337 offers a promising therapeutic strategy for targeting malignancies driven by this receptor.

C14orf48 antibody was raised in rabbit using the N terminal of C14orf48 as the immunogen

Mycophenolate mofetil

A synthetic peptide for use as a blocking control in assays to test for specificity of FEM1B antibody, catalog no. 70R-6027

ACPT antibody was raised using the middle region of ACPT corresponding to a region with amino acids TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND

Mal-amido-PEG12-acid

Rabbit Polyclonal IRS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC59 antibody, catalog no. 70R-6890

AUH antibody was raised in Rabbit using Human AUH as the immunogen

Rabbit polyclonal ZNF192 antibody

Please enquire for more information about MZ1 including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CD9 antibody, catalog no. 70R-10260

Please enquire for more information about BAY-958 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit Polyclonal TAK1 antibody (Thr184)

CD83 antibody (PE) was raised in mouse using COS cells transfected with human CD83 as the immunogen.

Human sequence expressed in NS0 Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

Goat anti-rabbit IgG (Fab'2) (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.

Kifunensine

Purified recombinant E.coli map protein

Cinaciguat is a pharmacological agent that activates guanylate cyclase. It has been shown to increase the level of intracellular cGMP, a second messenger that is involved in the regulation of diverse physiological processes, including blood pressure and heart rate. Cinaciguat has been shown to be effective for treatment of pulmonary hypertension and severe chronic heart failure. Cinaciguat may be an experimental biomarker for these conditions and other diseases with similar symptoms. The mechanism of action of cinaciguat is not fully understood, but it can be speculated that it inhibits the enzyme adenylyl cyclase by binding to its regulatory site on the beta-subunit of the enzyme.

TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP

2-Deoxy-2-fluoro-D-lactose

A synthetic peptide for use as a blocking control in assays to test for specificity of ACP1 antibody, catalog no. 70R-3910

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

WNT4 antibody was raised using the middle region of WNT4 corresponding to a region with amino acids HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE

HCN3 antibody was raised using the middle region of HCN3 corresponding to a region with amino acids LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV

ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids  KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR

H-WRWGWRWGTMLLGMLMICSA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WRWGWRWGTMLLGMLMICSA-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WRWGWRWGTMLLGMLMICSA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WRWGWRWGTMLLGMLMICSA-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of Rerg antibody, catalog no. 70R-9848

The Ebola Virus antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody is specifically designed to target and neutralize the glycoprotein of the Ebola virus. It has been extensively tested and proven to be highly effective in detecting and binding to the virus, making it an essential component in research and diagnostics related to Ebola. The activated form of this monoclonal antibody exhibits cytotoxic properties, meaning it can selectively destroy cells that are infected with the Ebola virus. This makes it a valuable asset in developing potential treatments or therapies for this deadly disease. In addition to its biochemical applications, this monoclonal antibody can also be used in other scientific fields such as helicobacter research or nuclear studies. Its unique characteristics, including its colloidal nature and amide composition, make it suitable for various experimental techniques and assays. With its exceptional specificity and potency, the Ebola Virus antibody opens up new possibilities for understanding and combating this highly infectious pathogen. Researchers and scientists can rely on

PRKRA antibody was raised using the middle region of PRKRA corresponding to a region with amino acids RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA

Rabbit Polyclonal ARAF antibody

Rabbit polyclonal TNNI3 antibody

Peptide Ac-LDKNKDPLNETV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using Ac-LDKNKDPLNETV-NH2 include the following: Improved survival of murine island skin flaps by prevention of reperfusion injury SH Tatlidede, AD Murphy, MC McCormack - Plastic and , 2009 - journals.lww.comhttps://journals.lww.com/plasreconsurg/fulltext/2009/05000/Reperfusion_Injury.5.aspx Attenuation of the effects of rat hemorrhagic shock with a reperfusion injury-inhibiting agent specific to mice C Ahmadi-Yazdi, B Williams , S Oakes, FD Moore Jr - Shock, 2009 - journals.lww.comhttps://journals.lww.com/shockjournal/fulltext/2009/09000/Transient_Receptor_Potential_Vanilloid_1.00011.aspx

Rabbit polyclonal Ki67 antibody

Inhibitor of human O-GlcNAcase

Biotin-NY-ESO-1 (157-165) - General analog epitope of tumor cells Biotin-NY-ESO-1 (157-165) C165V peptide is the N-ter biotinylated version of NY-ESO-1 (157-165) C165V peptide. It can be used in the analysis of antigen-specific T cells. HLA-A*02 Major Histocompatibility Complex (MHC) allele HLA-A*02 allele is expressed in class I Human MHC Leukocyte Antigens (HLA), that are cell surface receptors, presenting peptides to the immune system. If a non-self-peptide is recognized by cytotoxic T-cells in the blood, cell death will be initiated via apoptosis. NY-ESO-1 protein Peptides presented by MHC class I molecule, are usually between 7 and 11 amino acids, originating from proteins expressed by the cell. SLLMWITQV peptide differes from the New York esophageal squamous cell carcinoma 1 (NY-ESO-1 : UniProt - P78358) native SLLMWITQC peptide, whose protein is part of a well-characterized group of cancer/testis antigens (CTAs). Normally, NY-ESO-1 expression is restricted to germ cells and placental cells. However it is also expressed in 82% of neuroblastomas and 46% of melanomas, as well as in many other solid tumors and hematological malignancies. NY-ESO-1 (157-165) C165V peptide application Class I HLA molecules of the cancerous cells cited above present peptides from NY-ESO-1 protein, including SLLMWITQC, that binds the binding cleft of the HLA-A*0201 complex. NY-ESO-1 being the most immunogenic among the CTA family members, its peptides constitute attractive targets for specific immunotherapies and the stimulation of human NY-ESO-1 specific CD8+ T cells. In order to better stimulate specific cytotoxic T-cells in PBMCs and analyze by ELISPOT peptide epitope, specificity, and cytokine production, like IFN-γ, SLLMWITQV variant peptide was used, as it is known to have a higher affinity for the binding cleft of the HLA-A*0201 complex than the native peptide. Moreover, SLLMWITQV has been used with adjuvant in protein nanoparticles in order to study cell-mediated immune responses and is also used in clinical trial to study the immunological effects of vaccines containing NY-ESO-1 (157-165) C165V. SB-PEPTIDE also offers the scrambled version of NY-ESO-1 (157-165) C165V peptide, as well as NY-ESO-1 (157-165) native peptide.

H-LAAWTSSGP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAAWTSSGP-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAAWTSSGP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAAWTSSGP-OH at the technical inquiry form on this page

Purified Polyclonal CAV1 antibody

JNJ 28871063 hydrochloride is a cationic small molecule that can target cancer cells by binding to overexpressed ICAM-1. It is an experimental drug candidate that has been shown to inhibit tumor growth and reduce the size of tumors in animal models. JNJ 28871063 hydrochloride is also able to selectively cross the blood brain barrier and bind to brain tumor cells, indicating that it may be useful for treating cancers in this area. The drug has been encapsulated in liposomes or hydrogels, which are designed to release the drug at a controlled rate and prevent it from being metabolized before it reaches its target.

Please enquire for more information about ACTH antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF547 antibody, catalog no. 20R-1098

4,6-O-Benzylidene-D-maltose

Huperzine C is a Chinese herb that has been shown to inhibit the enzyme acetylcholinesterase, which is involved in the breakdown of acetylcholine. Huperzine C may be useful for the treatment of degenerative diseases and neurological disorders such as Alzheimer's disease or Parkinson's disease. This compound is also used as an analytical reagent for detecting proteins and fatty acids. Huperzine C can be found in huperzia serrata, an evergreen plant native to China and Taiwan.