Biochemicals and Reagents

M617 is a cyclic peptide that is a potent inhibitor of galanin. It has been shown to be effective in the treatment of diabetic neuropathy and other neurological disorders, such as Alzheimer's disease, Parkinson's disease, and multiple sclerosis. M617 binds to the receptor for galanin and blocks its binding site on the cell surface, thereby inhibiting the function of galanin. M617 also inhibits Jak2V617F activity and thus prevents activation of transcription-polymerase chain reaction (PCR). M617 has been shown to be an antidiabetic agent that regulates insulin secretion by acting on adipose tissue and pancreatic beta cells. M617 has also been shown to have diagnostic properties, which may be due to its ability to bind to serum bile acids or act as a radioligand for imaging purposes.

A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 20R-1124

Serotonin receptor and histamine (H1) receptor antagonist

Peptide H-DPAPRRGEPHVTRRTPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DPAPRRGEPHVTRRTPDYFL-OH include the following: Subunit interactions control protein phosphatase 2A. Effects of limited proteolysis, N-ethylmaleimide, and heparin on the interaction of the B subunit C Kamibayashi, R Estes, C Slaughter - Journal of Biological , 1991 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0021925818988319

The Oxycodone antibody is a specific monoclonal antibody that has cytotoxic properties. It is designed to specifically target and neutralize oxycodone, a potent opioid pain medication. This antibody works by binding to the oxycodone molecules and preventing them from interacting with their target receptors in the body. This not only reduces the analgesic effects of oxycodone but also helps to minimize its potential for abuse and addiction. The Oxycodone antibody has been extensively tested in various preclinical models and has shown promising results in reducing the effects of oxycodone overdose. It has the potential to be used as an effective therapeutic option for managing opioid addiction and overdose cases.

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR49 antibody, catalog no. 70R-3997

ZNF258 antibody was raised in rabbit using the middle region of ZNF258 as the immunogen

FD-211

Cotinine-4-HRP Antigen

Equine Serum Albumin (ESA) is a protein commonly used in veterinary applications. It plays a crucial role in various biological processes, including protein disulphide bond formation, transportation of antibodies, and lectin binding. ESA has also been studied for its potential hemolytic properties. In the field of life sciences, ESA has been used as a valuable tool in research studies. It is often utilized as a standard or control in experiments involving ubiquitin E3 ligase assays, antibody production, and the development of new medicaments. Additionally, ESA has been employed in the purification and characterization of human serum proteins. Monoclonal antibodies are widely used in medical research and diagnostics. ESA has proven to be an effective carrier protein for conjugating monoclonal antibodies, enhancing their stability and prolonging their half-life in vivo. ESA has also been investigated for its potential applications in collagen-related research. Collagenases are enzymes that degrade collagen fibers, and ESA has shown inhibitory effects on these

MGSSHHHHHH SSGLVPRGSH MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSG

A synthetic peptide for use as a blocking control in assays to test for specificity of TSG101 antibody, catalog no. 20R-1144

Dengue NS1 Protein Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Dengue NS1 Protein Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Commd2 antibody was raised in rabbit using the middle region of Commd2 as the immunogen

4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) is a ligand that binds to the GABAA receptor. It has been shown to activate this receptor by binding to the alpha subunit of the GABAAR. This receptor is responsible for mediating inhibitory signals in the brain. Activation of this receptor leads to an increase in chloride ion influx, which causes hyperpolarization of neurons and thus reduces neuronal activity. 4,4'-Methylenebis(5-methyl-1H-pyrrole-2-carbaldehyde) has also been shown to be a competitive inhibitor of peptides that bind to the GABAA receptor, such as baclofen and muscimol. !--END-->

Purified Polyclonal THRA antibody

Rabbit polyclonal Basigin antibody (HRP)

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

3-Methyl-1-phenyl-2(1H)-pyridinone is a medicinal compound that has shown promising results in inhibiting kinases, which are enzymes that play a crucial role in cell signaling pathways. This compound has been studied extensively for its potential as an anticancer agent due to its ability to induce apoptosis (programmed cell death) in cancer cells. It is a potent inhibitor of protein kinase C and has been found to be effective against various types of tumors, including breast cancer and lung cancer. 3-Methyl-1-phenyl-2(1H)-pyridinone is an analog of the Chinese herbal medicine Shikonin and has also shown activity as a urinary bladder tumor inhibitor. Its potential as a therapeutic agent for cancer treatment makes it an exciting area of research in the field of medicinal chemistry.

Rabbit polyclonal CDK2 antibody

Please enquire for more information about Deltasonamide 2 (TFA) including the price, delivery time and more detailed product information at the technical inquiry form on this page

Brucella Abortus IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Brucella Abortus IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.

Applications Dutasteride is a dual inhibitor of 5α-reductase isoenzymes type 1 and 2; structurally related to Finasteride (F342000). Dutasteride is used in the treatment of benign prostatic hyperplasia. References Bakshi, R.K., et al.: J. Med. Chem., 38, 3189 (1995), Gisleskog, P.O., et al.: Brit. J. Clin. Pharmacol., 47, 53 (1999), Djavan, B., et al.: Expert Opin. Pharmacother., 6, 311 (2005),

Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL

STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen

Mouse monoclonal PDE4B antibody

CCNH antibody was raised in Rabbit using Human CCNH as the immunogen

This sequence corresponds to the peptide bond between mammalian Lys33- (K33) linked Ub proteins- where (GG) corresponds to the C-terminus of the side chain appended Ub.Lys33-linked polyUb chains are assembled by the HECT E3 ligase AREL1. K33-linked polyUb chains have been linked to DNA damage response and in the regulation of innate immunity. Ubiquitination with K33-linked chains also regulates T-cell receptor function and contributes to the stabilization of actin for post-Golgi transport.

Human IgM Monoclonal Antibody

Bix-02188

DL-Glyceraldehyde (Dimer)

H-NLMNLGATL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NLMNLGATL-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NLMNLGATL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NLMNLGATL-OH at the technical inquiry form on this page

Peptide H-ICDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ICDFGLAR^-OH include the following: SMaSh: a streptavidin mass shift assay for rapidly quantifying target occupancy by irreversible inhibitors MT Labenski, LA Bateman, LT Voortman - Biochemistry, 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.biochem.1c00422 Proteomics data repositories M Riffle , JK Eng - Proteomics, 2009 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/pmic.200900216 Redox regulation, rather than stress-induced phosphorylation, of a Hog1 mitogen-activated protein kinase modulates its nitrosative-stress-specific outputs C Herrero-de-Dios, AM Day, AT Tillmann, SL Kastora - MBio, 2018 - Am Soc Microbiolhttps://journals.asm.org/doi/abs/10.1128/mbio.02229-17 Targeted covalent inactivation of protein kinases by resorcylic acid lactone polyketides A Schirmer, J Kennedy , S Murli - Proceedings of the , 2006 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.0600445103

LHRH.

Immunoglobulins IgM Heavy Tryptic Peptide Standard for protein identification and quantitation studies. IgM is an antibody isotype that is the first type to be produced when the body is invaded by a pathogen and therefore a key indication of infection.

Sec11c antibody was raised in rabbit using the C terminal of Sec11c as the immunogen

Mouse monoclonal Zika virus envelope antibody

AP2B1 antibody was raised using the middle region of AP2B1 corresponding to a region with amino acids SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP

Mouse monoclonal HIV1 p17 Antibody; immunogen Bacterially expressed, hexahistidine amino-terminal tagged HIV-1 p17 Gag protein (clade B, HXB-3 isolate).

N-methyl-D-aspartate receptors (NMDARs) are ligand-gated ionotropic glutamate receptors that mediate excitatory synaptic transmission and play important roles in many aspects of nervous system function including: synaptic plasticity- learning and memory- neuronal development and circuit formation. NMDARs have been implicated in various neuronal disorders. NMDARs are heteromers consisting of an obligate NR1 subunit and most commonly one or two kinds of NR2 subunits or occasionally NR3 subunits. NR2B is the predominant subunit found in the postnatal brain, however over time the number of NRA2 subunits increase and eventually outnumber NR2B subunits in a process known as the NR2B-NR2A developmental switch. The greater ratios of the NR2B subunit in post-natal brains leads to NMDA receptors which remain open longer compared to those with more NR2A subunits, this may be related to the greater memory abilities in the immediate postnatal period compared to late in life. NR2B improves synaptic plasticity and memory when over-expressed in neurones. The involvement of NMDAR in the central nervous system (CNS) has become a focus area for neurodegenerative diseases such as Alzheimer's disease, epilepsy and ischemic neuronal cell death.The TAT peptide is present due to its properties as a cell penetrating cationic peptide (CPP). It derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). As a CPP, TAT is able facilitate the delivery of NR2B (C-ter) across the plasma membrane.

Rabbit polyclonal NeuroD antibody (Ser274)

Purified recombinant Human NCK1 protein