Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of NXF1 antibody, catalog no. 70R-1323

Conjugated Phencyclidine-BSA hapten

Mouse anti-Malondialdehyde Antibody

Affinity purified Rabbit polyclonal HICE1 antibody

This antibody reacts with heavy chains on human IgE (epsilon chain).

6-Azido-6-deoxy-2,3-O-isopropylidene-α-L-sorbofuranose

Ac-EAAARAQAQAEAAARA-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-EAAARAQAQAEAAARA-NH2 is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-EAAARAQAQAEAAARA-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-EAAARAQAQAEAAARA-NH2 at the technical inquiry form on this page

Raf1 Kinase Inhibitor I is a small molecule inhibitor, which is synthetically derived to target the Raf1 kinase enzyme specifically. It operates by intervening in the kinase signaling pathways, particularly inhibiting the activity of Raf1 kinase, which is part of the MAPK/ERK pathway. This effectively impedes the downstream phosphorylation processes that are crucial for cell proliferation and differentiation. The inhibitor is primarily used in research to explore the complexities of Raf1 kinase's role within cellular signaling and to decipher the pathway's contribution to various cancer types and other proliferative diseases. By halting the Raf1 kinase activity, scientists can better understand the dynamics of cell signaling and develop potential therapeutic strategies. Raf1 Kinase Inhibitor I is also employed to explore resistance mechanisms in cancer therapies, providing insights into more effective combinatory treatments. Its application facilitates a deeper understanding of the intricate molecular mechanisms driving various pathological conditions.

Human sequence expressed in E. coli Cells; purity >95% by SDS-PAGE and analyzed by silver stain.

TMEM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Peptide H-DDSSESSDSGSSSESDGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-DDSSESSDSGSSSESDGD-OH include the following: MEPE has the properties of an osteoblastic phosphatonin and minhibin PSN Rowe, Y Kumagai, G Gutierrez, IR Garrett - Bone, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S875632820300382X

H-ISKYAGINILNVYSP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ISKYAGINILNVYSP-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ISKYAGINILNVYSP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ISKYAGINILNVYSP-OH at the technical inquiry form on this page

Bremelanotide is a synthetic cyclic peptide that is used for the treatment of female sexual dysfunction. It affects the physiological effects of sexual arousal by increasing blood flow to sexually sensitive tissue, and it has been shown to be effective in women with hypoactive sexual desire disorder as well as those who have not responded to other treatments. Bremelanotide binds to melanocortin receptors, which are expressed in the brain, on genital skin and in the pituitary gland. The drug has no significant interactions with other drugs and has a short half-life, making it suitable for use as an on-demand treatment.

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM5 antibody, catalog no. 70R-8274

Peptide H-GLFEAIEGFIENGWEGMIDGWYGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-GLFEAIEGFIENGWEGMIDGWYGC-OH include the following: Influence of endosome-destabilizing peptides on efficacy of anti-HIV immunotoxins VV Tolstikov , R Cole, H Fang, SH Pincus - Bioconjugate chemistry, 1997 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bc9600729 PEGylation improves nanoparticle formation and transfection efficiency of messenger RNA S uzgun, G Nica, C Pfeifer, M Bosinco - Pharmaceutical , 2011 - Springerhttps://link.springer.com/article/10.1007/s11095-011-0464-z Enhanced gene expression by a novel stearylated INF7 peptide derivative through fusion independent endosomal escape A El-Sayed , T Masuda, I Khalil , H Akita - Journal of controlled , 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S016836590900354X

Mouse monoclonal AKT1 antibody

Ac-CDEGEEPSPEALVRYL-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CDEGEEPSPEALVRYL-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CDEGEEPSPEALVRYL-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CDEGEEPSPEALVRYL-NH2 at the technical inquiry form on this page

HBX is a virus that infects humans and causes hepatitis B. It has been shown to replicate in human liver cells, where it produces an HBV-DNA polymerase. HBX protein has been shown to interact with the c-Src tyrosine kinase, which may play a role in its replication. HBX is also believed to contribute to tumorigenesis by activating the transcription factor NF-κB and inducing cell proliferation in some human cancer cells.

TLK1 antibody was raised using the middle region of TLK1 corresponding to a region with amino acids RQIDEQQKLLEKYKERLNKCISMSKKLLIEKSTQEKLSSREKSMQDRLRL

Rabbit anti-goat IgG (Alk Phos) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PSME3 antibody, catalog no. 70R-1072

Mouse monoclonal ZFAND2B antibody

1-(3-Beta-azido-2,3-dideoxy-beta-D-threopentafuranosyl)thymine is an inhibitor of ion channels. It is a ligand that binds to the beta subunit of voltage-gated potassium channels and blocks the opening of these channels. The binding site for 1-(3-Beta-azido-2,3-dideoxy-beta-D-threopentafuranosyl)thymine has been identified as being located in the selectivity filter region at the extracellular side of the channel. This compound has shown to be a potent inhibitor of ion channels with IC50s in the low nanomolar range.

Purified Recombinant Growth hormone receptor protein (His tagged)

Please enquire for more information about Digoxin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Affinity purified Rabbit polyclonal PI3 kinase p110 beta antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM23 antibody, catalog no. 70R-7942

CD104 antibody was raised in rat using tumor-associated antigen TSP-180 immunoaffinity purified from a transplantable BALB/c mouse lung cell carcinoma as the immunogen.

CDH2 antibody was raised in Mouse using a purified recombinant fragment of human CDH2 expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K1 antibody, catalog no. 70R-3666

Apo-enterobactin is a natural product produced by Streptomyces that plays a functional role in L-serine biosynthesis. It is an important molecule for the transport of iron in bacteria, and it has been shown to have potential applications in biotechnology and medicine. Apo-enterobactin is a unique molecule with a high affinity for iron, which makes it useful in capturing and transporting iron ions. This molecule has also been studied for its potential as an antibacterial agent, as it can inhibit the growth of certain bacterial strains by preventing them from acquiring essential nutrients such as iron. Overall, Apo-enterobactin is an important molecule with many potential applications in various fields of research.

MV1 is a protein that belongs to the group of calcium binding proteins. It has been shown to be an important biomarker for active antiretroviral therapy in HIV-infected patients. MV1 is also expressed at high levels in primary cells, such as T lymphocytes and macrophages, and can be used as a marker for cell lysis in model organisms, such as mice. The protein has been shown to have potential therapeutic applications in the treatment of obesity-related disorders by regulating body mass index (BMI). MV1 has also been shown to bind bacterial strains and viruses, which makes it a potential diagnostic tool. This protein can also act as a vector for experimental models.

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM98B antibody, catalog no. 70R-4262

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC728566 antibody, catalog no. 70R-9032

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

5-Iminodaunorubicin hydrochloride is a peptidomimetic that is a potent inhibitor of protein interactions. It binds to a receptor site on the target protein and inhibits its activity. 5-Iminodaunorubicin hydrochloride has been shown to be an effective inhibitor of the enzyme DNA topoisomerase II, which is involved in the production of dsDNA breaks.

Purified Polyclonal Cathepsin G antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GIPC3 antibody, catalog no. 70R-8498

Purified Polyclonal HOXA11/D11 antibody

Recombinant human EFNB2 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of ALDH1B1 antibody, catalog no. 70R-3238

Rabbit polyclonal ARHGEF17 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of OPN1MW antibody, catalog no. 70R-9882

Rabbit polyclonal STAU2 antibody

Rabbit polyclonal Met antibody

Mouse monoclonal PROM2 antibody

CUGBP1 antibody was raised in Rabbit using Human CUGBP1 as the immunogen

Rabbit polyclonal PARP antibody

Myoglobin antibody was raised in mouse using human cardiac myoglobin as the immunogen.

ELMOD2 antibody was raised in Rabbit using Human ELMOD2 as the immunogen

Armenian Hamster monoclonal CD29 antibody

Mouse sequence expressed in NS0 Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Fc Fusion Protein.

PDE10A Antibody

Dynamin 1 antibody was raised in Mouse using a purified recombinant fragment of human Dynamin-1 expressed in E. coli as the immunogen.

Purified native Human FSH protein (intact) (> 60% pure)

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Boc-Glu(OcHex)-OH is a peptide inhibitor that is used in research to study the effects of protein interactions. Boc-Glu(OcHex)-OH binds specifically to the receptor and blocks ligand binding, preventing activation. This drug is an ion channel activator and an antibody against this drug has been developed. Boc-Glu(OcHex)-OH is soluble in water at ambient temperatures and has a purity of 99%.

Purified Polyclonal BAG4 antibody

Peptide H-FSP^DDSAGASALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FSP^DDSAGASALLR^-OH include the following: Thyroglobulin and thyroid cancer WS Phipps, AN Hoofnagle , MY Roth, CM Shuford - Cancer Biomarkers, 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/B9780128243022000060 Clinical peptide and protein quantification by mass spectrometry (MS) SKG Grebe, RJ Singh - TrAC Trends in Analytical Chemistry, 2016 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0165993615301813 Quantitation of Thyroglobulin in Serum Using SISCAPA and Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS) JG van der Gugten , M Razavi, DT Holmes - Clinical Applications of Mass , 2022 - Springerhttps://link.springer.com/protocol/10.1007/978-1-0716-2565-1_42 A distributable LC-MS/MS method for the measurement of serum thyroglobulin J Shi, WS Phipps, BY Owusu, CM Henderson - Journal of Mass , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2667145X22000396 Influence of Thyroglobulin (Tg) Autoantibodies on Tg levels Measured by Different Methodologies:(IMA, LC-MS/MS and RIA) I Petrovic, J LoPresti, S Fatemi - The Journal of , 2024 - academic.oup.comhttps://academic.oup.com/jcem/advance-article-abstract/doi/10.1210/clinem/dgae286/7659925 B-187 Evaluation of Clinical Utility of LC-MS/MS Method for Thyroglobulin Measurement in Comparison with Immunoradiometric Assay and Chemiluminescence E Yoon, S Kim, H Oh, H Park, S Kim, S Lee - Clinical Chemistry, 2023 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/69/Supplement_1/hvad097.518/7283590 Serum thyroglobulin evaluation on LC-MS/MS and immunoassay in TgAb-positive patients with papillary thyroid carcinoma E Nishihara, Y Hobo, A Miyauchi, Y Ito - European Thyroid , 2022 - etj.bioscientifica.comhttps://etj.bioscientifica.com/view/journals/etj/11/1/ETJ-21-0041.xml First Steps Toward Harmonization of LC-MS/MS Thyroglobulin Assays To the Editor DI TgIA, B Coulter - Clinical Chemistry, 2016 - researchgate.nethttps://www.researchgate.net/profile/Stefan-Grebe/publication/282425553_First_Steps_toward_Harmonization_of_LC-MSMS_Thyroglobulin_Assays/links/5645f67108ae9f9c13e7295b/First-Steps-toward-Harmonization-of-LC-MS-MS-Thyroglobulin-Assays.pdf More sensitivity is always better: measuring sub-clinical levels of serum thyroglobulin on a µLC-MS/MS system CM Shuford, JS Johnson , JW Thompson - Clinical Mass , 2020 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S2376999820300015 Lessons learned: establishing a CLIA-equivalent laboratory for targeted mass spectrometry assays-navigating the transition from research to clinical practice CL Han, CT Lai, AJ Reyes , HC Yang, JY Lu, SR Shih - Clinical Proteomics, 2024 - Springerhttps://link.springer.com/article/10.1186/s12014-024-09455-y Clinical irrelevance of lower titer thyroglobulin autoantibodies in patients with differentiated thyroid carcinoma BL Dekker, ANA van der Horst-Schrivers - European Thyroid , 2022 - etj.bioscientifica.comhttps://etj.bioscientifica.com/view/journals/etj/11/6/ETJ-22-0137.xml Usefulness of a thyroglobulin liquid chromatography-tandem mass spectrometry assay for evaluation of suspected heterophile interference BC Netzel, SKG Grebe - Clinical Chemistry, 2014 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/60/7/1016/5621619 First steps toward harmonization of LC-MS/MS thyroglobulin assays BC Netzel, RP Grant, AN Hoofnagle - Clinical , 2016 - academic.oup.comhttps://academic.oup.com/clinchem/article-abstract/62/1/297/5611812 Development of a pregnancy-specific reference material for thyroid biomarkers, vitamin D, and nutritional trace elements in serum ASP Boggs, LE Kilpatrick, CQ Burdette - Clinical Chemistry and , 2021 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/cclm-2020-0977/html Rapid and accurate quantitation of thyroglobulin biomarkers using the Echo® MS+ system with ZenoTOF 7600 system A Stella, JW McCabe, A Bhalkikar - sciex.comhttps://sciex.com/content/dam/SCIEX/pdf/tech-notes/biopharma/MKT-31267-A_Rapid_peptide_quant_FINAL_KAW_JM_APS_v4_JK.pdf Antibody Characterization for use in Clinical Mass Spectrometry A Moore - 2018 - digital.lib.washington.eduhttps://digital.lib.washington.edu/researchworks/handle/1773/42880 Thyroglobulin measurement in the management of patients with differentiated thyroid cancer A Algeciras-Schimnich - Critical Reviews in Clinical Laboratory , 2018 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/10408363.2018.1450830

Rabbit polyclonal RAC2 antibody

Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RPPGFSPFR^-OH include the following: Tumor-penetrating peptides T Teesalu , KN Sugahara, E Ruoslahti - Frontiers in oncology, 2013 - frontiersin.orghttps://www.frontiersin.org/articles/10.3389/fonc.2013.00216/full Substrate specificity studies of the cysteine peptidases falcipain-2 and falcipain-3 from Plasmodium falciparum and demonstration of their kininogenase activity SS Cotrin, IE Gouvacaªa, PMS Melo, P Bagnaresi - Molecular and , 2013 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0166685113000042 Differences in substrate and inhibitor sequence specificity of human, mouse and rat tissue kallikreins SE Fogaaca, DC Pimenta , K Hosoi - Biochemical , 2004 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/380/3/775/43987 Design of substrate-type ACE inhibitory pentapeptides with an antepenultimate C-terminal proline for efficient release of inhibitory activity S Rao, S Liu, T Ju, W Xu, G Mei, Y Xu - Biochemical engineering , 2012 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1369703X11002634 Characterization of permethylated beta-cyclodextrin-peptide noncovalently bound complexes using electron capture dissociation mass spectrometry (ECD MS) S Lee, S Ahn, S Park, HB Oh - International Journal of Mass Spectrometry, 2009 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S138738060800420X The structural basis for peptide selection by the transport receptor OppA RPA Berntsson , MK Doeven, F Fusetti - The EMBO , 2009 - embopress.orghttps://www.embopress.org/doi/abs/10.1038/emboj.2009.65 Neprilysin carboxydipeptidase specificity studies and improvement in its detection with fluorescence energy transfer peptides NMT Barros, M Campos, PA Bersanetti , V Oliveira - 2007 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/BC.2007.048/html Mitochondrial intermediate peptidase: Expression in Escherichia coli and improvement of its enzymatic activity detection with FRET substrates MF Marcondes , RJS Torquato , DM Assis - Biochemical and , 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0006291X09021743 Fragmentation of doubly-protonated peptide ion populations labeled by H/D exchange with CD3OD KA Herrmann, K Kuppannan, VH Wysocki - International journal of mass , 2006 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1387380606000170 Design of a serum stability tag for bioactive peptides K Jambunathan, AK Galande - Protein and Peptide Letters, 2014 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/ppl/2014/00000021/00000001/art00006 An unexpected cell-penetrating peptide from Bothrops jararaca venom identified through a novel size exclusion chromatography screening JM Sciani , H Vigerelli, AS Costa - Journal of Peptide , 2017 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.2965 of the Fukien Gold-Striped Pond Frog, Pelophylax plancyi fukienensis: A Prototype of a Novel Class of Bradykinin B2 Receptor Antagonist Peptide from Ranid Frogs J Ma, Y Luo, L Ge, L Wang, M Zhou - The Scientific World , 2014 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1155/2014/564839 Human recombinant membrane-bound aminopeptidase P: production of a soluble form and characterization using novel, internally quenched fluorescent substrates G Molinaro, AK Carmona , MA Juliano - Biochemical , 2005 - portlandpress.comhttps://portlandpress.com/biochemj/article-abstract/385/2/389/41742 Combinatorial peptide libraries reveal the ligand-binding mechanism of the oligopeptide receptor OppA of Lactococcus lactis FJM Detmers, FC Lanfermeijer - Proceedings of the , 2000 - National Acad Scienceshttps://www.pnas.org/doi/abs/10.1073/pnas.220308797 2Kinetics and Specificity of Peptide Uptake by the FJM Detmers, ERS Kunji, FC Lanfermeijer - Transport System of - research.rug.nlhttps://research.rug.nl/files/3112665/thesis.pdf#page=29 Kinetics and Specificity of Peptide Uptake by the Oligopeptide Transport System of Lactococcus lactis FJM Detmers, ERS Kunji , FC Lanfermeijer - Biochemistry, 1998 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi981712t Kinetics and Consequences of Binding of Nona- and Dodecapeptides to the Oligopeptide Binding Protein (OppA) of Lactococcus lactis FC Lanfermeijer, A Picon, WN Konings, B Poolman - Biochemistry, 1999 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/bi9914715 Gamma ray irradiation of the vasoactive peptide bradykinin reveals a residue-and position-dependent structural modification DT Nardi, JC Rosa , GN Jubilut, A Miranda - Journal of Peptide , 2010 - Springerhttps://link.springer.com/article/10.1007/s10989-010-9205-0 S1' and S2' subsite specificities of human plasma kallikrein and tissue kallikrein 1 for the hydrolysis of peptides derived from the bradykinin domain of human AR Lima , FM Alves, PF Angelo, D Andrade , SI Blaber - 2008 - degruyter.comhttps://www.degruyter.com/document/doi/10.1515/BC.2008.166/html Bradykinin and its metabolite, Arg-Pro-Pro-Gly-Phe, are selective inhibitors of alpha-thrombin-induced platelet activation AAK Hasan , S Amenta, AH Schmaier - Circulation, 1996 - Am Heart Assochttps://www.ahajournals.org/doi/abs/10.1161/01.CIR.94.3.517 Mechanisms of Arg-Pro-Pro-Gly-Phe inhibition of thrombin AAK Hasan , M Warnock, M Nieman - American Journal , 2003 - journals.physiology.orghttps://journals.physiology.org/doi/abs/10.1152/ajpheart.00490.2002 Peptide binding to the Bacillus subtilis oligopeptide-binding proteins OppA and AppA A Picon, KHM van Wely - Molecular Biology Today, 2001 - caister.comhttps://www.caister.com/backlist/mbt/v/v2/05.pdf

H-LQQLGGGEAIPLEGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LQQLGGGEAIPLEGR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LQQLGGGEAIPLEGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LQQLGGGEAIPLEGR-OH at the technical inquiry form on this page

Amyloid β precursor-like protein 2 (APLP2) (also known as YWK-II) is a type I transmembrane protein belonging to the amyloid precursor protein (APP) gene family. The APP gene family also contains APP and APLP1 and has been associated with Alzheimer's disease pathogenesis as well as playing a pivotal role in processes underlying normal brain development and postnatal survival. APLP2 is ubiquitously expressed during embryonic development and in most adult tissues, in a pattern largely overlapping with APP. APLP2 is processed by alpha-, β- and γ-secretase and its cleavage is regulated by insulin-like growth factor 1 (IGF-1), epidermal growth factor, phorbol 12-myristate 13-acetate (PMA), and retinoic acid.APLP2 has been linked to the development and progression of a number of cancer types, including pancreatic, Ewing's sarcoma, colon, breast, lung and prostate cancer where it is often overexpressed, although significant downregulation of APLP2 is seen in neuroendocrine lung tumours. APLP2 expression is often associated with abnormal growth, migration and invasion in cancer cells. APLP2 expression may increase gradually with the advancement of cancer progression. Different APLP2 splice isoforms may have an influence on cancer development.The Lysine residue at position 17 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (2), giving this peptide a mass increase of 8 compared to the unlabelled peptide.

Mouse monoclonal Vibrio cholerae O1 Inaba antibody

Affinity purified Rabbit polyclonal LRP12 antibody

Anti-ROBO1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Tmed1 antibody, catalog no. 70R-8661

Purified native Human Transferrin protein (Holo)

Mouse monoclonal OXSR1 antibody

Please enquire for more information about Alarelin acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

Murashige and Skoog basal medium with vitamins

A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC6B antibody, catalog no. 70R-3155

3x DYKDDDDK peptide, also called 3x FLAG peptide, is a 23 aa length peptide used for the competitive elution of DYKDDDDK-tag fusion proteins (with excess of free 3x DYKDDDDK peptide) under non-denaturing conditions, especially when a DYKDDDDK-tagged protein is sensitive to low pH. Involvement in COVID-19 disease Some recombinant proteins, such as Spike glycoprotein and ACE2 are frequently produced using the FLAG-tag system. In order to elute such proteins purified by affinity, sb-PEPTIDE provides DYKDDDDK peptide and 3x DYKDDDDK peptide. To help your research for COVID-19 disease, we can also provide you with premium quality peptide libraries containing SARS-CoV-2 proteins. Our expertise make us able to synthesize glycopeptides and phosphopeptides to be close from the real content of these peptides. For more information, please visit this link

Peptide H-ERFALNPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ERFALNPGL-OH include the following: CCR5-edited CD4+ T cells augment HIV-specific immunity to enable post-rebound control of HIV replication P Tebas , JK Jadlowsky, PA Shaw - The Journal of , 2024 - Am Soc Clin Investighttps://www.jci.org/articles/view/144486

Hydroxychloroquine O-?-D-glucuronide

FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Purified recombinant Human ANXA8L2 Protein (His tag)

Purified recombinant CYB5R1 protein (His tag)

IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ

CROT antibody was raised in Rabbit using Human CROT as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of KIRREL2 antibody, catalog no. 70R-6136