Biochemicals and Reagents

Anti Cephapirin C monoclonal

Carcino Embryonic Antigen CEA Monoclonal Antibody

H-YATGDIIGDIRQAHC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YATGDIIGDIRQAHC-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YATGDIIGDIRQAHC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YATGDIIGDIRQAHC-OH at the technical inquiry form on this page

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

CHKtide is a synthetic peptide substrate for checkpoint kinase 1 and 2 (CHK1/CHK2) as well as salt-inducible kinase (SIKs), for use in kinase assays. CHKtide has been derived from CDC25C which is phosphorylated by CHK1/CHK2 in one of the DNA repair pathways. SIKs are serine/threonine kinases that are part of a complex network that regulate sodium homeostasis and blood pressure.The valine residue at position 4 has been isotopically labelled with carbon-13(5) and nitrogen-15(1) and the leucine residue at position 19 has been isotopically labelled with carbon-13(6) and nitrogen-15(1). This isotopic labelling gives this peptide a mass increase of 13 compared to the unlabelled peptide.

CD19 antibody (Allophycocyanin) was raised in rat using murine CD19-expressing K562 human erythroleukemia cells as the immunogen.

Peptide H-SFGNPFEPQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFGNPFEPQAR^-OH include the following: Purification and Characterization of Ca2+/Calmodulin-Dependent Protein Kinase Kinase beta from Rat Cerebellum S Okuno, T Kitani, H Fujisawa - The journal of biochemistry, 1997 - academic.oup.comhttps://academic.oup.com/jb/article-abstract/121/1/155/806897

Econazole Nitrate chemical reference substance

A synthetic peptide for use as a blocking control in assays to test for specificity of KRT16 antibody, catalog no. 70R-2870

Anti-ROBO1 antibody

Sheep polyclonal Triamcinolone Acetonide antibody

Please enquire for more information about o-Ethyl (5-bromoquinoxalin-6-yl)carbamothioate including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of HMGCS2 antibody, catalog no. 70R-1139

BAT3 (340-347) human is derived from BAT3, the human leukocyte antigen B-associated transcript 3 which associates with TIM-3 in T lymphocytes and recruits a Src family kinase.

Purified native Ectromelia virus protein (Mouse)

Peptide H-LNEVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-LNEVAK^-OH include the following: Investigation of the Catalytic Mechanism of a Soluble N-glycosyltransferase Allows Synthesis of N-glycans at Noncanonical Sequons Z Hao, Q Guo, Y Feng, Z Zhang, T Li, Z Tian, J Zheng - JACS Au, 2023 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacsau.3c00214 Coronavirus-induced autoimmunity V Salle - Clinical Immunology, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S1521661621000310 Evaluacion in silico del potencial autoinmunogenico de la proteaca­na S del SARS-CoV-2 OR Serrano-Barrera , MacaR Agramonte , O Perez - eventoshematologia.sld.cuhttps://eventoshematologia.sld.cu/index.php/hematologia23/2023/paper/download/363/413 Untangling COVID-19 and autoimmunity: Identification of plausible targets suggests multi organ involvement M Mohkhedkar, SSK Venigalla , V Janakiraman - Molecular Immunology, 2021 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0161589021002029 SARS-CoV-2 Infection and Guillain-Barre Syndrome H Makhluf, H Madany - Pathogens, 2021 - mdpi.comhttps://www.mdpi.com/2076-0817/10/8/936 Anti-neuronal antibodies against brainstem antigens are associated with COVID-19 G Lucchese , A Vogelgesang , F Boesl, D Raafat - , 2022 - thelancet.comhttps://www.thelancet.com/journals/ebiom/article/PIIS2352-3964(22)00393-0/fulltext Molecular mimicry between SARS-CoV-2 and respiratory pacemaker neurons G Lucchese , A Flöel - Autoimmunity reviews, 2020 - ncbi.nlm.nih.govhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC7252083/ Frequently asked questions in patients with adrenal insufficiency in the time of COVID-19 C Sabbadin, C Betterle, C Scaroni - Frontiers in , 2021 - frontiersin.orghttps://www.frontiersin.org/journals/endocrinology/articles/10.3389/fendo.2021.805647

Rabbit polyclonal Ephrin-B2 antibody

ZNF280B antibody was raised in rabbit using the C terminal of ZNF280B as the immunogen

H-Ile-His-OH is a peptide that has been found to be an antagonist of the epidermal growth factor receptor. It has been shown to decrease inflammation in animal models of bowel disease and may be useful in the treatment of inflammatory bowel disease. H-Ile-His-OH has also been shown to inhibit the production of inflammatory cytokines such as IL-1β, IL-6, and TNF α. This peptide also inhibits monoclonal antibody production by dendritic cells and can prevent resistant mutants from developing. H-Ile-His-OH is a potent antagonist of Toll-Like Receptor (TLR) 4, TLR2, TLR3, and TLR9. H-Ile-His-OH is currently being investigated for its possible role in the treatment of infectious diseases and autoimmune diseases.

Peptide H-SIIVFNLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SIIVFNLL^-OH include the following: Isolation of tumour-reactive lymphocytes from peripheral blood via microfluidic immunomagnetic cell sorting Z Wang , S Ahmed , M Labib , H Wang, L Wu - Nature Biomedical , 2023 - nature.comhttps://www.nature.com/articles/s41551-023-01023-3 Immune-based mutation classification enables neoantigen prioritization and immune feature discovery in cancer immunotherapy P Bai, Y Li, Q Zhou, J Xia, PC Wei , H Deng - , 2021 - Taylor & Francishttps://www.tandfonline.com/doi/abs/10.1080/2162402X.2020.1868130 Characters of neoantigens in cancer immunotherapy P Bai, Y Li, Q Zhou, J Xia, M Wu, H Deng, JW Kappler - bioRxiv, 2019 - researchgate.nethttps://www.researchgate.net/profile/Philippa-Marrack/publication/334462311_Characters_of_neoantigens_in_cancer_immunotherapy/links/5f80a085a6fdccfd7b5520a6/Characters-of-neoantigens-in-cancer-immunotherapy.pdf DNA engineered lymphocyte-based homologous targeting artificial antigen-presenting cells for personalized cancer immunotherapy L Sun, F Shen, Z Xiong, H Yang , Z Dong - Journal of the , 2022 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/jacs.1c09316 Amplificacion de la respuesta antitumoral mediada por linfocitos T CD8+ de memoria residente JP Saavedra Almarza - 2019 - repositorio.uchile.clhttps://repositorio.uchile.cl/handle/2250/174671 Tissue-resident memory CD8+ T cells amplify anti-tumor immunity by triggering antigen spreading through dendritic cells E Menares, F Galvez-Cancino - Nature , 2019 - nature.comhttps://www.nature.com/articles/s41467-019-12319-x

AMARA peptide is a fragment containing the phosphorylation site for AMP activated protein kinase (AMPK) and is a substrate for all AMPK subfamily kinases. As such it is used to measure AMPK related kinase activity.

Peptide H-TTNYT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-TTNYT-OH include the following: In vivo depression of lymphocyte traffic in sheep by VIP and HIV (AIDS)-related peptides TC Moore, CH Spruck, SI Said - Immunopharmacology, 1988 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0162310988900069 Chemokine Receptor Antagonists Prevent and Reverse Cofilin-Actin Rod Pathology and Protect Synapses in Cultured Rodent and Human iPSC-Derived Neurons TB Kuhn , LS Minamide, LH Tahtamouni , SA Alderfer - Biomedicines, 2024 - mdpi.comhttps://www.mdpi.com/2227-9059/12/1/93 18 A TOXIC PROTEIN FROM THE AIDS VIRUS ROSSI. BRINKWORTH, ANNELIESE F. PALMER SL RAMSDALE, PR ANDREWS - Toxins and Targets: Effects of , 1992 - books.google.comhttps://books.google.com/books?hl=en&lr=&id=O-3DGeeWmAoC&oi=fnd&pg=PA149&dq=(%22H-TTNYT-OH%22+OR+%22H-TTNY%5ET-OH%22+OR+%22TTNYT%22+OR+%22TTNY%5ET%22)+AND+peptide&ots=YuLpeHhnYG&sig=GbWjtAD2bgGV9mLT5Sy_pK_7VCM Minimum analogue peptide sets (MAPS) for quantitative structure-activity relationships S Hellberg , L Eriksson, J Jonsson - journal of peptide , 1991 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1991.tb00756.x A Toxic Protein from the Aids Virus RI Brinkworth, AF Palmer, SL Ramsdale - Toxins and , 2022 - taylorfrancis.comhttps://www.taylorfrancis.com/chapters/edit/10.4324/9781315076911-18/toxic-protein-aids-virus-ross-brinkworth-anneliese-palmer-stephen-ramsdale-peter-andrews Vasoactive intestinal peptide 1-12: A ligand for the CD4 (T4)/human immunodeficiency virus receptor P Sacerdote, MR Ruff, CB Pert - Journal of neuroscience , 1987 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/jnr.490180117 VIP1-12 Is a Ligand for the CD4/Human Immunodeficiency Virus Receptor P Sacerdote, MR Ruff, CB Pert - of the New York Academy of , 1988 - Wiley Online Libraryhttps://nyaspubs.onlinelibrary.wiley.com/doi/abs/10.1111/j.1749-6632.1988.tb27010.x CD4 receptor binding peptides that block HIV infectivity cause human monocyte chemotaxis: Relationship to vasoactive intestinal polypeptide MR Ruff, BM Martin, EI Ginns, WL Farrar, CB Pert - FEBS letters, 1987 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0014579387812656 Management of glia-mediated neuroinflammation and related patents M Kumar Jha , K Suk - Recent Patents on Inflammation & Allergy , 2014 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/iad/2014/00000008/00000002/art00004 Peptide T blocks GP120/CCR5 chemokine receptor-mediated chemotaxis LS Redwine , CB Pert, JD Rone, R Nixon, M Vance - Clinical , 1999 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S152166169994771X AIDS as a neuropeptide disorder: does HIV bind to a VIP receptor? JM Hill, AI Kook, A Harris - : 1 and 2 Proceedings of the XVIth CINP , 1990 - Springerhttps://link.springer.com/chapter/10.1007/978-3-642-74034-3_72 Probing the conformational and dynamical effects of O-glycosylation within the immunodominant region of a MUC1 peptide tumor antigen J Schuman, AP Campbell, RR Koganty - Journal of peptide , 2003 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2003.00031.x Impact of point mutations on the structure and thermal stability of ribonuclease T1 in aqueous solution probed by Fourier transform infrared spectroscopy H Fabian, C Schultz, J Backmann , U Hahn - Biochemistry, 1994 - ACS Publicationshttps://pubs.acs.org/doi/pdf/10.1021/bi00201a021 A new vasoactive intestinal peptide antagonist discriminates VIP receptors on guinea pig trachea and human neuroblastoma cells F Leroux, JF Goossens, N Pommery, JP Henichart - Regulatory peptides, 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/0167011594900442 The role of microglial cells on neuroinflammation: possible therapeutic applications DM de Oliveira, N OS Camara - Recent Patents on , 2012 - ingentaconnect.comhttps://www.ingentaconnect.com/content/ben/rpgm/2012/00000002/00000003/art00005 gp120 as an etiologic agent for NeuroAIDS: neurotoxicity and model systems DE Brenneman, SK McCune, RF Mervis - Advances in , 1994 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0960542806802524 Peptide T sequences prevent neuronal cell death produced by the envelope protein (gp 120) of the human immunodeficiency virus DE Brenneman, JM Buzy, MR Ruff - Drug development , 1988 - Wiley Online Libraryhttps://analyticalsciencejournals.onlinelibrary.wiley.com/doi/abs/10.1002/ddr.430150403 Peptide Intervention in Neuronal Death Caused by the HIV External Envelope Protein: Clinical Implications DE Brenneman - Neuropsychopharmacology: 1 and 2 Proceedings of , 1990 - Springerhttps://link.springer.com/chapter/10.1007/978-3-642-74034-3_71 Peptide T revisited: conformational mimicry of epitopes of anti-HIV proteins D Picone , A Rivieccio, O Crescenzi - Journal of Peptide , 2001 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/psc.320 Tritiated D-ala1-peptide T binding: A pharmacologic basis for the design of drugs which inhibit HIV receptor binding CC Smith, PL Hallberg, P Sacerdote - Drug development , 1988 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/pdf/10.1002/ddr.430150404 SHORT COMMUNICATION HYPOTENSIVE EFFECTS OF PEPTIDE T IN CONSCIOUS RATS C Wen, DT Liu, M Li, J Michaelis - Clinical and , 1997 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1111/j.1440-1681.1997.tb02120.x

A synthetic peptide for use as a blocking control in assays to test for specificity of OTUB2 antibody, catalog no. 70R-9723

KLHDC4 antibody was raised in Rabbit using Human KLHDC4 as the immunogen

H-WKEATTTLFCASDAR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WKEATTTLFCASDAR-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WKEATTTLFCASDAR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WKEATTTLFCASDAR-OH at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of Fa2h antibody, catalog no. 70R-7969

H-AEALKEALAPVPIPF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AEALKEALAPVPIPF-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AEALKEALAPVPIPF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AEALKEALAPVPIPF-OH at the technical inquiry form on this page

Peptide 5TAMRA-KKRYDREFLLGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using 5TAMRA-KKRYDREFLLGF-OH include the following: Improved eIF4E binding peptides by phage display guided design: plasticity of interacting surfaces yield collective effects W Zhou , ST Quah, CS Verma , Y Liu , DP Lane - 2012 - journals.plos.orghttps://journals.plos.org/plosone/article?id=10.1371/journal.pone.0047235 A novel unstructured scaffold based on 4EBP1 enables the functional display of a wide range of bioactive peptides HY See, DP Lane - Journal of molecular biology, 2010 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0022283610010818

Peptide H-PFRDYVDRFFKTLRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PFRDYVDRFFKTLRA-OH include the following: Cross-Reactive Potential of HIV-1 Subtype C-Infected Indian Individuals Against Multiple HIV-1 Potential T Cell Epitope Gag Variants N Negi, M Vajpayee, R Singh , A Sharma - Viral , 2016 - liebertpub.comhttps://www.liebertpub.com/doi/abs/10.1089/vim.2016.0060

Rabbit polyclonal RPS18 antibody

Inhibitor of dihydroorotate dehydrogenase; anti-inflammatory; immunomodulatory

A synthetic peptide for use as a blocking control in assays to test for specificity of TYRP1 antibody, catalog no. 70R-7374

TPPU is a selective inhibitor of soluble epoxide hydrolase (sEH), which is derived from chemical synthesis. TPPU acts by competitively binding to the sEH enzyme, thereby preventing the conversion of epoxyeicosatrienoic acids (EETs) into their less active dihydroxy derivatives. This inhibition results in elevated levels of EETs, which are known to exhibit vasodilatory, anti-inflammatory, and analgesic properties. The uses and applications of TPPU are mainly focused on research and potential therapeutic interventions in various pathological conditions. The compound is extensively studied for its role in reducing inflammation and chronic pain. Additionally, TPPU has shown promising results in the context of neuroprotection, as well as in the modulation of cardiovascular and renal functions. Researchers are investigating its potential efficacy in treating conditions such as hypertension, atherosclerosis, stroke, and other inflammatory diseases. The compound thus represents a promising candidate for the development of novel therapeutics aimed at exploiting the beneficial actions of elevated EET levels in various disease states.

hCG antibody was raised in rabbit using hCG beta as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SFRS10 antibody, catalog no. 70R-1420

H-CQLIIHMLKTEAKMRAN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CQLIIHMLKTEAKMRAN-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CQLIIHMLKTEAKMRAN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CQLIIHMLKTEAKMRAN-OH at the technical inquiry form on this page

K 134 is a benzimidazole derivative that has been shown to be an effective inhibitor of muscle cell proliferation. K 134 inhibits the activity of fatty acid synthase and prevents the synthesis of eicosanoids, which are important mediators of inflammation. The inhibition of fatty acid synthase by K 134 may be due to its ability to bind to the active site and competitively inhibit the binding of acetyl-CoA. K 134 also has a dry weight-increasing effect on gastrocnemius muscle cells in rats, which is due to its ability to inhibit protein degradation as well as stimulate protein synthesis. K 134 has been shown to be effective against P. aeruginosa in a primary analysis and in vitro experiments, but it is not yet known whether this drug will be effective for humans.

Erythrosin Free Acid

Peptide H-CGNYTCEVTELTREGETIIELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CGNYTCEVTELTREGETIIELK-OH include the following: Simultaneous identifying the infarct core, collaterals, and penumbra after acute ischemic stroke with a low-immunogenic MRI nanoprobe P Zhang, W Li, C Liu, L Zhu, J Cheng, R Pang, Y Lan - Materials & Design, 2023 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0264127523006263

Rabbit polyclonal NFKP p105/p50 antibody

ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids GQVGVNVPIPVPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQW

H-NTWTTCQSIAFPSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NTWTTCQSIAFPSK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NTWTTCQSIAFPSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NTWTTCQSIAFPSK-OH at the technical inquiry form on this page

Mouse monoclonal SDR9C7 antibody

Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Biotin-PEG2-Amine

Purified native Adenovirus protein (Mouse)

HLA-A*02 is a class I major histocompatibility complex (MHC) allele which is part of the HLA-A group of human major histocompatibility complex (MHC) leukocyte antigens (HLA), found at the HLA-A locus. HLA-A is one of three major types of human MHC class I cell surface receptors. The receptor is a heterodimer, and is composed of a heavy alpha chain and smaller β chain. MHC Class I molecules such as HLA-A are part of a process that presents short polypeptides to the immune system. These polypeptides are typically 7-11 amino acids in length and originate from proteins being expressed by the cell. Cytotoxic T cells in the blood "read" the peptide presented by the complex and should only bind to non-self peptides. If binding occurs, a series of events is initiated culminating in cell death via apoptosis. This peptide corresponds to the Hepatitis B variant (HBV) core sequence which is presented on the MHC class I antigen HLA-A*02 and contains fluorescein, a widely used flourescent dye.

Peptide H-SLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SLSYR-OH include the following: Nitrate-driven anaerobic oxidation of ethane and butane by bacteria M Wu , J Li, CY Lai , AO Leu , S Sun, R Gu - The ISME , 2024 - academic.oup.comhttps://academic.oup.com/ismej/article-abstract/18/1/wrad011/7512816

Catalogue peptide; min. 95% purity

N-(2,4-Dichlorobenzyl)-1-propyl-1H-benzo[D]imidazol-5-amine is an ion channel activator that binds to the glutamate receptor. It is a useful tool for research in pharmacology, protein interactions, and pharmacology. This compound has been shown to have inhibitory effects on the activity of the NMDA receptor and AMPA receptors. N-(2,4-Dichlorobenzyl)-1-propyl-1H-benzo[D]imidazol-5-amine can also be used as an antibody to activate ion channels with high purity. CAS No. 912780-51-9

Mouse monoclonal BUB1B antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Guf1 antibody, catalog no. 70R-9515

IL33 antibody was raised in Rabbit using Human IL33 as the immunogen

SCNN1B antibody was raised using a synthetic peptide corresponding to a region with amino acids QPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

ELISA kit for the detection of Annexin V in the research laboratory

The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.

A synthetic peptide for use as a blocking control in assays to test for specificity of Bmp2 antibody, catalog no. 70R-8617

A synthetic peptide for use as a blocking control in assays to test for specificity of CXCL14 antibody, catalog no. 20R-1308

Rabbit polyclonal RPL10A antibody

Recombinant Mouse TPT1 protein with His tag

Fluridone

Mouse monoclonal MAP2K2 antibody

This Thermo Scientific Chemicals brand product was originally part of the Acros Organics product portfolio. Some documentation and label information may refer to the legacy brand. The original Acros Organics product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

ZNF529 antibody was raised in rabbit using the middle region of ZNF529 as the immunogen

Human sequence expressed in sf Insect Cells; purity >95% by SDS-PAGE and analyzed by silver stain.

GAS7 antibody was raised in Rabbit using Human GAS7 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMC4 antibody, catalog no. 70R-4333

Rabbit Polyclonal NFkB p65 antibody (Ser468)

DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

1-231 amino acids: MGSSHHHHHH SSGLVPRGSH MAGKKVLIVY AHQEPKSFNG SLKNVAVDEL SRQGCTVTVS DLYAMNFEPR ATDKDITGTL SNPEVFNYGV ETHEAYKQRS LASDITDEQK KVREADLVIF QFPLYWFSVP AILKGWMDRV LCQGFAFDIP GFYDSGLLQG KLALLSVTTG GTAEMYTKTG VNGDSRYFLW PLQHGTLHFC GFKVLAPQIS FAPEIASEEE RKGMVAAWSQ RLQTIWKEEP IPCTAHWHFG Q

Rabbit polyclonal IL10R alpha antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf47 antibody, catalog no. 70R-3346

Anti-phospho-TDP-43 (pS409/pS410) antibody

Please enquire for more information about rac Deoxy-o-desmethyl venlafaxine including the price, delivery time and more detailed product information at the technical inquiry form on this page

AHNAK antibody was raised in mouse using recombinant Human Ahnak Nucleoprotein (Desmoyokin) (Ahnak)

β2 adrenoreceptor agonist

A synthetic peptide for use as a blocking control in assays to test for specificity of NPTX2 antibody, catalog no. 70R-9388

CD90.2 antibody (Azide free) was raised in rat using CD90.2/'Thy-1.2 alloantigen as the immunogen.

The SNAI1 antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits BACE1, an enzyme involved in the production of amyloid-beta peptides. These peptides are known to play a crucial role in the development of Alzheimer's disease. The SNAI1 antibody has been extensively studied and has shown promising results in neutralizing BACE1 activity, thus potentially slowing down the progression of the disease. Additionally, this antibody has low density dimers, which allows for enhanced penetration into tissues and improved therapeutic efficacy. Its unique glycosylation pattern also contributes to its stability and cytotoxicity against cancer cells. With its potential as a diagnostic tool and medicament, the SNAI1 antibody holds great promise in advancing our understanding and treatment options for various diseases related to BACE1 activity and growth factors.

Purified recombinant MOB1B protein (His tag)

Peptide H-ASDPSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ASDPSLK-OH include the following: Quantification of ricin, RCA and comparison of enzymatic activity in 18 Ricinus communis cultivars by isotope dilution mass spectrometry SM Prezioso, AJ Carter, YM Williamson, SC McGrath - Toxicon, 2015 - researchgate.nethttps://www.researchgate.net/profile/David-Schieltz/publication/270595184_Quantification_of_Ricin_RCA_and_Comparison_of_Enzymatic_Activity_in_18_Ricinus_Communis_Cultivars_by_Isotope_Dilution_Mass_Spectrometry/links/54bcedaf0cf253b50e2d85ff/Quantification-of-Ricin-RCA-and-Comparison-of-Enzymatic-Activity-in-18-Ricinus-Communis-Cultivars-by-Isotope-Dilution-Mass-Spectrometry.pdf Quantitative detection of ricin in beverages using trypsin/Glu-C tandem digestion coupled with ultra-high-pressure liquid chromatography-tandem mass spectrometry LH Liang, X Cheng, HL Yu, Y Yang, XH Mu - Analytical and , 2021 - Springerhttps://link.springer.com/article/10.1007/s00216-020-03030-8 Lc-hrms screening and identification of novel peptide markers of ricin based on multiple protease digestion strategies LH Liang, CC Liu, B Chen, L Yan, HL Yu, Y Yang - Toxins, 2019 - mdpi.comhttps://www.mdpi.com/2072-6651/11/7/393 Ricin-like proteins from the castor plant do not influence liquid chromatography-mass spectrometry detection of ricin in forensically relevant samples ED Merkley , SC Jenson, JS Arce, AM Melville - Toxicon, 2017 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S004101011730301X Quantification of ricin, RCA and comparison of enzymatic activity in 18 Ricinus communis cultivars by isotope dilution mass spectrometry DM Schieltz, LG McWilliams, Z Kuklenyik, SM Prezioso - Toxicon, 2015 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0041010115000069

UCP2 antibody was raised in rabbit using a 14 amino acid peptide from mouse UCP2 as the immunogen.

Please enquire for more information about Placental Lactogen Human including the price, delivery time and more detailed product information at the technical inquiry form on this page

Prostaglandin E2 receptor antagonist