Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of DGKE antibody, catalog no. 70R-5996

Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.

Purified Polyclonal BNIP2 antibody

Affinity purified Rabbit polyclonal ZNF346 antibody

Rabbit polyclonal NFKB p105 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MAPT antibody, catalog no. 70R-6021

Please enquire for more information about Lyso-PAF C-16-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of PGP 9.5 antibody, catalog no. 20R-PG011

SSX8 antibody was raised in rabbit using the C terminal of SSX8 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CXorf26 antibody, catalog no. 70R-4351

Heroin Conjugate for use in immunoassays

Purified Recombinant Havcr1 protein (His tagged)

Recombinant HTLV 1+2

Rabbit anti Monkey IgG (H + L) secondary antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PSMA4 antibody, catalog no. 70R-4317

A synthetic peptide for use as a blocking control in assays to test for specificity of CD40 antibody, catalog no. 70R-6008

Rabbit polyclonal ABHD2 antibody

Goat anti-rat IgG (H+L) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.

7-Chloro-3-[2-(6-cyclopropyl-1H-indol-3-yl)-2-oxoethoxy]naphthalene-2-carboxamide is a research tool that acts as an activator of the Ligand, Receptor, Cell Biology, Antibody, Ion channels, CAS No. 1965261-97-5. It is a high purity product with a purity of 99% and has a CAS number of 1965261-97 to 5. This product is used in pharmacology to study protein interactions and life science to study inhibitor activities.

ELISA kit for detection of CD40 in the research laboratory

Purified native Ovomucoid protein (Chicken)

Involucrin antibody (biotin) was raised in mouse using human keratinocytes’ involucrin as the immunogen.

H-IQIDPVK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IQIDPVK-OH is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IQIDPVK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IQIDPVK-OH at the technical inquiry form on this page

Complement factor B is a vital factor in the alternative pathway of the complement system and is involved in the formation of the C3 convertase, a crucial activator of the complement cascade. The alternative pathway is activated by auto-activation in which complement 3 (C3) becomes hydro-lysed. When binding to hydrolysed C3 factor B is cleaved by factor D. From the products Ba and Bb, generated from this cleavage, Bb makes up the C3 convertase (C3bBb). Due to its serine protease domain Bb has the ability when associated with hydrolysed C3, to cleave C3 molecules to produce the C3b in the C3 convertase. Factor B can be used as a marker of the alternative pathway in re-search.Overall the main functions of the complement system is to mark cells for phagocytosis, the recruitment of inflammatory cells and the cell lysis of bacteria cell by the MAC. Anaphylatoxins produced recruit neutrophils and causes the inflammatory response while the MAC produces pores in the bacterial membrane thus causing a Ca2+ influx into the cell and bacterial cell death.The inappropriate activation of the alternative pathways could contribute to diseases such as spon-taneous fetal loss in mice, macular degeneration and Asthma. The complement system as a whole can be associated with- neurological diseases, bacterial meningitis, thrombotic disorders, and autoimmune diseases.The proline residue at position 10 is isotopically labelled with carbon-13 (5) and nitrogen-15 (1).

Rabbit polyclonal RARG antibody

Methyl 2,6-di-O-benzyl-?-D-galactopyranoside

H-FSSLGCLEGDTYVVNPN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FSSLGCLEGDTYVVNPN-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FSSLGCLEGDTYVVNPN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FSSLGCLEGDTYVVNPN-OH at the technical inquiry form on this page

Rabbit polyclonal GABARAPL2 antibody (HRP)

Please enquire for more information about Luteinizing Hormone antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Mouse monoclonal RhoGDI antibody

Mouse sequence expressed in sf Insect Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

MGP antibody was raised using the middle region of MGP corresponding to a region with amino acids INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM

Angiotensinogen antibody was raised in mouse using rat angiotensinogen as the immunogen.

Albumin antibody was raised in Mouse using Human albumin as the immunogen.

Rabbit polyclonal PAK1IP1 antibody

H-IYPTDGYTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IYPTDGYTR-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IYPTDGYTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IYPTDGYTR-OH at the technical inquiry form on this page

DAZ4 antibody was raised using the N terminal of DAZ4 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Phenolphthalein 4'-O-?-D-glucuronide

HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL

Please enquire for more information about Ciramadol including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf53 antibody, catalog no. 70R-3724

Cefoxitin (USP grade powder) chemical reference substance

Mouse monoclonal POR antibody

Mouse monoclonal Cytokeratin 10+13 antibody

Peptide H-VEITYTPSDGTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VEITYTPSDGTQK^-OH include the following: Targeted proteomics identifies liquid-biopsy signatures for extracapsular prostate cancer Y Kim, J Jeon , S Mejia, CQ Yao, V Ignatchenko - Nature , 2016 - nature.comhttps://www.nature.com/articles/ncomms11906

Mouse monoclonal CNOT4 antibody

Dnp-Pro-beta-cyclohexyl-Ala-Gly-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 is a versatile building block that can be used in the synthesis of complex compounds, research chemicals and reagents. It has been shown to be useful in the synthesis of high quality, useful intermediates and reaction components. Dnp-Pro-beta-cyclohexyl-Ala-Gly-Cys(Me)-His-Ala-Lys(N--Me--Abz)-NH2 is also a useful scaffold for the preparation of biologically active compounds.

Peptide H-SFEDIHQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SFEDIHQYR-OH include the following: Systematic approach to group-specific isotopic labeling of proteins for vibrational spectroscopy B Warscheid, S Brucker, A Kallenbach , HE Meyer - Vibrational , 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0924203107001038

Please enquire for more information about N-Trifluoroacetodesmethyl citalopram-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of Arsg antibody, catalog no. 70R-9308

Mouse monoclonal TMOD1 antibody

Purified recombinant COX5B protein (His tag)

Rabbit polyclonal DCLK2 antibody

This C-terminal Sortagging peptide acts as an (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Cys(AF680)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.C-Terminal Sortagging-[Cys(AF680)]  peptide contains the AF680 fluorescent dye- AF680 is a bright green dye with excitation at 633 nm, well suited for flow cytometry and imagery. AF680 is particularly photostable, allowing better detection of low abundance conjugates.  C-Terminal Sortagging-[Cys(AF680)] amide is provided here. However, the acid version is also available in our catalogue.

Peptide H-KTSAVLQSGFRKME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KTSAVLQSGFRKME-OH include the following: Colorimetric and electrochemical methods for the detection of SARS-CoV-2 main protease by peptide-triggered assembly of gold nanoparticles Y Feng, G Liu , M La, L Liu - Molecules, 2022 - mdpi.comhttps://www.mdpi.com/1420-3049/27/3/615 Peptide functionalized nanocarriers for targeted drug delivery in cancer therapy P Loganathan, M Magzoub - Biophysical journal, 2023 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(22)02565-6.pdf SARS-CoV-2 3CLpro mutations selected in a VSV-based system confer resistance to nirmatrelvir, ensitrelvir, and GC376 E Heilmann , F Costacurta, SA Moghadasi - Science translational , 2022 - science.orghttps://www.science.org/doi/abs/10.1126/scitranslmed.abq7360 A genetically encoded BRET-based SARS-CoV-2 Mpro protease activity sensor AM Geethakumari , WS Ahmed , S Rasool - Communications , 2022 - nature.comhttps://www.nature.com/articles/s42004-022-00731-2 A genetically encoded BRET-based SARS-CoV-2 main protease activity sensor AM Geethakumari , WS Ahmed , S Rasool, A Fatima - Biophysical , 2023 - cell.comhttps://www.cell.com/biophysj/pdf/S0006-3495(22)02562-0.pdf

Peptide H-RRPHFP^QFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-RRPHFP^QFSYSASGTA-OH include the following: Regulation of protein kinase B/Akt activity and Ser473 phosphorylation by protein kinase Calpha in endothelial cells C Partovian , M Simons - Cellular signalling, 2004 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0898656804000191

Jnj-47117096 hydrochloride is a research tool that can be used for studying the activation and ligand binding of receptors. It is a peptide with a molecular weight of 971.5 Da. The CAS number for this product is 1610536-69-0. Jnj-47117096 hydrochloride is an inhibitor of ion channels and can be used to study the influence of ion channels on cell biology, pharmacology, and life science.

Morphine 3 antibody was raised in goat using 3-carboxymethyl-morphine-BSA as the immunogen.

Purified Rabbit polyclonal BAIAP2L1 antibody

NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.

Recombinant Human CD34

Purified Polyclonal UGCG antibody

EB3 antibody was raised in Rat using Human EB3 fused to GST as the immunogen.

Purified recombinant Human IFNG Protein (His tag)

ELISA Kit for detection of ALCAM in the research laboratory

Paraformaldehyde is used as a disinfectant, hardening agent and waterproofing agent. It is also used to prepare adhesives, resins and dentistry as an antiseptic and contraceptive. It is also employed as a thermoplastic. In addition, it is used in the preparation of formalin fixatives for tissues or cells during the samples subjected to florescence studies. This Thermo Scientific Chemicals brand product was originally part of the Alfa Aesar product portfolio. Some documentation and label information may refer to the legacy brand. The original Alfa Aesar product / item code or SKU reference has not changed as a part of the brand transition to Thermo Scientific Chemicals.

A synthetic peptide for use as a blocking control in assays to test for specificity of TOB1 antibody, catalog no. 20R-1130

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNV2 antibody, catalog no. 70R-5119

Purified Polyclonal MSK1 antibody

Purified recombinant Human CCL3 protein

Peptide H-KLDLSNVQSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-KLDLSNVQSK^-OH include the following: Does data-independent acquisition data contain hidden gems? A case study related to Alzheimer's disease EE Hubbard , LR Heil, GE Merrihew - Journal of proteome , 2021 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/acs.jproteome.1c00558 Quantitative protein profiling by mass spectrometry using label-free proteomics AS Haqqani , JF Kelly, DB Stanimirovic - Genomics Protocols, 2008 - Springerhttps://link.springer.com/protocol/10.1007/978-1-59745-188-8_17

H-IQDLCLAVE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IQDLCLAVE-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IQDLCLAVE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IQDLCLAVE-OH at the technical inquiry form on this page

Mouse monoclonal BSG antibody

Purified recombinant Human PQBP1 Protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of MUC1 antibody, catalog no. 70R-6968

1,2-Distearoyl-sn-glycero-3-phosphoglycerol sodium is a research chemical that has potential applications in the diagnosis and treatment of various conditions. It is a phospholipid that plays a crucial role in cellular signaling and membrane structure. This compound has been studied for its potential use in the diagnosis of aspergillosis, a fungal infection. Additionally, 1,2-Distearoyl-sn-glycero-3-phosphoglycerol sodium has been investigated for its interactions with other compounds such as XL888 and polysaccharides like cycloheterophyllin. It is also used in experiments related to dopamine signaling and cellulose oligosaccharides. With its diverse range of applications, this compound holds promise for further research and development in the field of pharmaceuticals and diagnostics.

H-RALIKTLPRASYSSH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RALIKTLPRASYSSH-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RALIKTLPRASYSSH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RALIKTLPRASYSSH-OH at the technical inquiry form on this page

Rabbit polyclonal NUMB antibody

Please enquire for more information about Cyclohexanol-d11 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified recombinant Human CLEC2D protein (His tag)

Peptide H-VSSLPSVTLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-VSSLPSVTLK-OH include the following: Targeted CHO cell engineering approaches can reduce HCP-related enzymatic degradation and improve mAb product quality T Dovgan, V Golghalyani, F Zurlo - Biotechnology and , 2021 - Wiley Online Libraryhttps://onlinelibrary.wiley.com/doi/abs/10.1002/bit.27857 Cathepsin D: Removal strategy on protein A chromatography, near real time monitoring and characterisation during monoclonal antibody production T Cui, B Chi, JH Thompson, T Kasali, C Sellick - Journal of , 2019 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168165619308302